@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0580: (2015-12-02 )
MAVENEGVLLVLSSPSGAGKTTILERLLERSTNLVRSVSMTTRKPRPGEINGKDYFFVTKKEFHELCEAGQMLEYARVFENFYGIPKSFIEQNLSSGISVLLSIDWQGAFHLFELMREKVISVFILPPSMEELRLRLQKRNSDSASEIEHRLAEAQKEMSKRDKYDYVVINDDIDKSVEEISSILDKERLKRSGV

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_S_19(2AN9)
KGUA_ECOLI
[Raw transfer]




G5P_J_10(2F3R)
KGUA_ECOLI
[Raw transfer]




G5P_G_7(2F3R)
KGUA_ECOLI
[Raw transfer]




0O2_D_18(4QRH)
?
[Raw transfer]




0O2_B_8(4QRH)
?
[Raw transfer]




5GP_M_13(2ANB)
KGUA_ECOLI
[Raw transfer]




0O2_C_12(4QRH)
?
[Raw transfer]




GDP_M_13(2AN9)
KGUA_ECOLI
[Raw transfer]




5GP_A_4(3TR0)
KGUA_COXBU
[Raw transfer]




5GP_A_4(3TR0)
KGUA_COXBU
[Raw transfer]




5GP_D_15(2J41)
KGUA_STAAC
[Raw transfer]




5GP_B_8(2J41)
KGUA_STAAC
[Raw transfer]




5GP_C_11(2J41)
KGUA_STAAC
[Raw transfer]




5GP_D_4(1EX7)
KGUA_YEAST
[Raw transfer]




5GP_D_4(1EX7)
KGUA_YEAST
[Raw transfer]




5GP_D_4(1GKY)
KGUA_YEAST
[Raw transfer]




FMT_B_2(1Z8F)
KGUA_MYCTU
[Raw transfer]




FMT_A_3(1S4Q)
KGUA_MYCTU
[Raw transfer]




ADP_C_3(1LVG)
KGUA_MOUSE
[Raw transfer]




ADP_C_3(1LVG)
KGUA_MOUSE
[Raw transfer]




LGP_G_7(2F3T)
KGUA_ECOLI
[Raw transfer]




LGP_G_7(2F3T)
KGUA_ECOLI
[Raw transfer]




LGP_G_7(2F3T)
KGUA_ECOLI
[Raw transfer]




LGP_G_7(2F3T)
KGUA_ECOLI
[Raw transfer]




POP_A_3(2QOR)
?
[Raw transfer]




5 PsiBlast_PDB 94.5644%-115 - C5 -2F3T 3.4 KGUA_ECOLI
22 PsiBlast_CBE 94.1944%-116 - C5 -2F3T 3.8 KGUA_ECOLI
23 PsiBlast_CBE 94.0544%-118 - C5 -2F3T 3.5 KGUA_ECOLI
3 PsiBlast_PDB 93.0944%-108 - C5 -2ANC - KGUA_ECOLI -
24 PsiBlast_CBE 93.0544%-113 - C5 -2F3R 9.6 KGUA_ECOLI
21 PsiBlast_CBE 92.7544%-115 - C5 -2F3T 2.7 KGUA_ECOLI
6 PsiBlast_PDB 92.0544%-106 - C5 -1S96 - KGUA_ECOLI -
4 PsiBlast_PDB 91.5844%-113 - C5 -2F3R 9.4 KGUA_ECOLI
25 PsiBlast_CBE 91.0744%-107 - C5 -2AN9 6.4 KGUA_ECOLI
57 HHSearch 91.0145%-111 * C5 *1S96 - KGUA_ECOLI -
1 PsiBlast_PDB 90.5544%-109 - C5 -2AN9 6.4 KGUA_ECOLI
2 PsiBlast_PDB 89.8844%-107 - C5 -2ANB 7.2 KGUA_ECOLI
7 PsiBlast_PDB 88.1842%-109 - C5 -3TR0 6.4 KGUA_COXBU
46 HHSearch 87.9034%-123 - C5 -1ZNW - KGUA_MYCTU -
28 PsiBlast_CBE 87.3140%-107 - C5 -4QRH 10.1 ?
40 HHSearch 86.8838%-108 - C5 -3TAU - KGUA_LISMO -
9 PsiBlast_PDB 86.2640%-122 - C5 -2J41 - KGUA_STAAC -
8 PsiBlast_PDB 86.2340%-115 - C5 -4QRH - ? -
29 PsiBlast_CBE 85.9740%-119 - C5 -2J41 6.9 KGUA_STAAC
26 PsiBlast_CBE 85.4640%-109 - C5 -4QRH 10.0 ?
30 PsiBlast_CBE 85.1740%-115 - C5 -2J41 7.1 KGUA_STAAC
31 PsiBlast_CBE 85.0140%-116 - C5 -2J41 6.8 KGUA_STAAC
43 HHSearch 83.7340% -98 - C5 -3TR0 6.4 KGUA_COXBU
15 PsiBlast_PDB 82.5037%-111 - C5 -1Z8F 3.4 KGUA_MYCTU
20 PsiBlast_PDB 82.3536% -82 - C5 -1LVG 7.1 KGUA_MOUSE
44 HHSearch 82.0736% -94 - C5 -1LVG 7.1 KGUA_MOUSE
10 PsiBlast_PDB 81.8337%-106 - C5 -1S4Q 3.5 KGUA_MYCTU
27 PsiBlast_CBE 81.4540%-108 - C5 -4QRH 10.0 ?
18 PsiBlast_PDB 79.9837% -99 - C5 -1GKY 7.0 KGUA_YEAST
41 HHSearch 79.7332% -87 - C5 -2QOR 3.0 ?
45 HHSearch 79.4036%-102 - C5 -1EX7 6.8 KGUA_YEAST
17 PsiBlast_PDB 79.1037%-101 - C5 -1EX7 6.8 KGUA_YEAST