@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0618: (2015-12-03 )
MHSPIISISNLHLSFNDKIILNDISLDILKGESLVILGSSGSGKSVLTKTIIGLLAPDSGSIKINSKSKNKFGVLFQNSALFDYVAVWENISFNYRKRFNISKKEAKQLAIEKLNDVGLEKNIADMFPIELSGGMKKRVALARAIAHNPEIIMLDEPTSGLDPIMSDIVKETIVKLSKDPSPTIITITHDIHDAFKIADKIAVLYEGSIISHGTVQEIKNTKNEYIKKFIRYVGTK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




25 PsiBlast_CBE 91.1934%-113 - C1 -4U02 - ? -
26 PsiBlast_CBE 88.8134%-107 - C1 -4U02 - ? -
7 PsiBlast_PDB 88.8034%-109 - C1 -4U00 - ? -
8 PsiBlast_PDB 88.2634%-105 - C1 -4U02 - ? -
24 PsiBlast_CBE 86.0134%-102 - C1 -4U02 - ? -
9 PsiBlast_PDB 81.6634% -96 - C1 -2YYZ - ? -
4 PsiBlast_PDB 81.4836%-103 - C1 -4YMV - ? -
2 PsiBlast_PDB 81.4236%-105 - C1 -4YMT - ? -
1 PsiBlast_PDB 80.9136%-105 - C1 -4YMS - ? -
3 PsiBlast_PDB 80.8136%-103 - C1 -4YMU 5.4 ?
67 PsiBlast_CBE 80.2332%-109 - C1 -3C41 7.5 ?
22 PsiBlast_CBE 80.1836%-101 - C1 -4YMU 5.3 ?
52 PsiBlast_CBE 79.8632%-110 - C1 -3C4J - ? -
63 PsiBlast_CBE 79.8332%-109 - C1 -2OLK - ? -
21 PsiBlast_CBE 79.4636%-100 - C1 -4YMV - ? -
23 PsiBlast_CBE 78.9637%-108 - C1 -2IT1 - ? -
5 PsiBlast_PDB 78.7536%-101 - C1 -4YMW - ? -
57 PsiBlast_CBE 78.5832%-104 * C1 *2OUK - ? -
66 PsiBlast_CBE 78.4532%-104 - C1 -3C41 - ? -
90 PsiBlast_CBE 78.2034% -99 - C1 -4MKI - ECFA2_CALS4 -