Study : Wbm0677 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C1_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C1_S1
Complex: AGS_B_6(3C4J) / Model_61(3C4J/B) = [3.2] Download539.467.47MLVNNISYLYNNQDDFALNNINIKVKRGKVACLLGHSGCGKSTILKLIAGIENPKSGTIFINDKLVASSSTSIAIEHRNIGLIFQHSALFPHKTVVENVTFAIRSSSKKEKHLIALEILKLLNIAKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFSNLDILLKCQIRQRILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGRIIQSGISSDIYHRPKDDTLAKFFSELSSTLQLGEKFPLDGAFAVRK
Complex: ATP_A_6(4YMV) / Model_49(4YMV/A) = [3.6] Download534.610.33MLVNNISYLYNNQDDFALNNINIKVKRGKVACLLGHSGCGKSTILKLIAGIENPKSGTIFINDKLVASSSTSIAIEHRNIGLIFQHSALFPHKTVVENVTFAIRSSSKKEKHLIALEILKLLNIAKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFSNLDILLKCQIRQRILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGRIIQSGISSDIYHRPKDDTLAKFFSELSSTLQLGEKFPLDGAFAVRK
Complex: ADP_B_6(2Q0H) / Model_63(2Q0H/B) = [3.6] Download873.090.67MLVNNISYLYNNQDDFALNNINIKVKRGKVACLLGHSGCGKSTILKLIAGIENPKSGTIFINDKLVASSSTSIAIEHRNIGLIFQHSALFPHKTVVENVTFAIRSSSKKEKHLIALEILKLLNIAKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFSNLDILLKCQIRQRILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGRIIQSGISSDIYHRPKDDTLAKFFSELSSTLQLGEKFPLDGAFAVRK
Complex: ADP_A_5(2OLJ) / Model_74(2OLJ/A) = [3.8] Download529.632.36MLVNNISYLYNNQDDFALNNINIKVKRGKVACLLGHSGCGKSTILKLIAGIENPKSGTIFINDKLVASSSTSIAIEHRNIGLIFQHSALFPHKTVVENVTFAIRSSSKKEKHLIALEILKLLNIAKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFSNLDILLKCQIRQRILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGRIIQSGISSDIYHRPKDDTLAKFFSELSSTLQLGEKFPLDGAFAVRK
Complex: AT4_A_5(2OLK) / Model_72(2OLK/A) = [3.8] Download433.940.86MLVNNISYLYNNQDDFALNNINIKVKRGKVACLLGHSGCGKSTILKLIAGIENPKSGTIFINDKLVASSSTSIAIEHRNIGLIFQHSALFPHKTVVENVTFAIRSSSKKEKHLIALEILKLLNIAKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFSNLDILLKCQIRQRILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGRIIQSGISSDIYHRPKDDTLAKFFSELSSTLQLGEKFPLDGAFAVRK
Consensus
[pKd Mean = 3.60]
-582
(s=150)
2
(s=2)
MLVNNISYLYNNQDDFALNNINIKVKRGKVACLLGHSGCGKSTILKLIAGIENPKSGTIFINDKLVASSSTSIAIEHRNIGLIFQHSALFPHKTVVENVTFAIRSSSKKEKHLIALEILKLLNIAKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFSNLDILLKCQIRQRILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGRIIQSGISSDIYHRPKDDTLAKFFSELSSTLQLGEKFPLDGAFAVRK