@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0677: (2015-12-03 )
MLVNNISYLYNNQDDFALNNINIKVKRGKVACLLGHSGCGKSTILKLIAGIENPKSGTIFINDKLVASSSTSIAIEHRNIGLIFQHSALFPHKTVVENVTFAIRSSSKKEKHLIALEILKLLNIAKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFSNLDILLKCQIRQRILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGRIIQSGISSDIYHRPKDDTLAKFFSELSSTLQLGEKFPLDGAFAVRK

Atome Classification :

(38 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




115 Fugue 82.4535%-134 - C1 -1Z47 - ? -
96 HHSearch 82.3239%-143 - C1 -1V43 - ? -
100 HHSearch 79.4445%-134 - C1 -2IT1 - ? -
101 HHSearch 78.6540%-129 - C1 -2YYZ - ? -
9 PsiBlast_PDB 78.1540%-143 - C1 -1V43 - ? -
27 PsiBlast_CBE 78.0738%-136 - C1 -3FVQ - FBPC_NEIG1 -
94 HHSearch 77.6536%-135 - C1 -1Z47 - ? -
26 PsiBlast_CBE 76.2136%-128 - C1 -1OXU - ? -
5 PsiBlast_PDB 76.1936%-129 - C1 -1OXU - ? -
21 PsiBlast_CBE 76.0645%-138 - C1 -2IT1 - ? -
23 PsiBlast_CBE 75.9236%-129 - C1 -1OXV - ? -
11 PsiBlast_PDB 75.0538%-135 - C1 -3FVQ - FBPC_NEIG1 -
7 PsiBlast_PDB 74.9535%-125 - C1 -1OXX - ? -
24 PsiBlast_CBE 74.9336%-124 - C1 -1OXV - ? -
95 HHSearch 74.7937%-133 - C1 -3FVQ - FBPC_NEIG1 -
97 HHSearch 74.7336%-128 - C1 -1OXX - ? -
1 PsiBlast_PDB 74.3445%-136 - C1 -2IT1 - ? -
25 PsiBlast_CBE 73.8636%-127 - C1 -1OXU - ? -
2 PsiBlast_PDB 73.7338%-138 - C1 -1Z47 - ? -
99 HHSearch 73.3537%-139 - C1 -3RLF - MALK_ECOLI -
50 PsiBlast_CBE 64.0533%-131 - C1 -4YMU 4.6 ?
62 PsiBlast_CBE 63.1332%-129 - C1 -3C4J 4.7 ?
51 PsiBlast_CBE 62.4433%-133 - C1 -4YMU 4.3 ?
69 PsiBlast_CBE 62.3732%-130 - C1 -2OLK 4.0 ?
61 PsiBlast_CBE 62.3032%-135 - C1 -3C4J 3.2 ?
49 PsiBlast_CBE 61.9633%-129 - C1 -4YMV 3.6 ?
74 PsiBlast_CBE 61.2932%-129 - C1 -2OLJ 3.8 ?
64 PsiBlast_CBE 61.0032%-129 - C1 -2Q0H 3.0 ?
63 PsiBlast_CBE 60.9732%-130 - C1 -2Q0H 3.6 ?
60 PsiBlast_CBE 60.7132%-132 - C1 -3C41 5.0 ?
48 PsiBlast_CBE 60.4333%-131 - C1 -4YMV 4.0 ?
71 PsiBlast_CBE 60.1932%-128 - C1 -2OLK 3.9 ?
72 PsiBlast_CBE 60.0532%-127 - C1 -2OLK 3.8 ?
92 PsiBlast_CBE 59.8832%-141 - C1 -1B0U 4.0 HISP_SALTY
58 PsiBlast_CBE 58.9434%-124 - C1 -4U00 4.2 ?
59 PsiBlast_CBE 57.4532%-133 - C1 -3C41 4.1 ?
73 PsiBlast_CBE 57.0532%-125 - C1 -2OLJ 3.8 ?
70 PsiBlast_CBE 56.9032%-130 - C1 -2OLK 4.1 ?