@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0708: (2015-12-04 )
MNSFYEMGLPLLLAQALDKNSFSVPTPVQAQAIPLALKGKDILGSAQTGTGKTLAFAIPLIAKLLGEPNASTALVIVPTRELAQQVTNEIGKLLLKNSVLKIALLIGGEPIFRQLNQLQRRPRIVIGTPGRIIDHIERKTLITNNVSTLVLDEVDRMFDMGFGIQIEGIMKYLPKMRQNLMFSATLPGDIVKLAEKYSNQPERVSVENEATTSVKIKQEIIYASESEKYGKLVTQLYQRKGSIIVFVRTKQRADQLAYKLRKDNHSALAIHGDLKQRKRKRVINSFRRGHNQIMVATDVASRGLDIPHIQHVINYDAPESQANYIHRTGRTARAGAEGYALSFITSQDKKRLPTLTDKKGELNFDCNVQFKKCSSKKVSRRPSALKIKYGRKKTSTFKKKSTVLEKIY

Atome Classification :

(42 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_3(2PL3)
DDX10_HUMAN
[Raw transfer]




ADP_A_3(2OXC)
DDX20_HUMAN
[Raw transfer]




ADP_B_4(2OXC)
DDX20_HUMAN
[Raw transfer]




ADP_B_5(4PX9)
DDX3X_HUMAN
[Raw transfer]




8OP_B_6(3MWK)
?
[Raw transfer]




AMP_A_3(3BER)
DDX47_HUMAN
[Raw transfer]




AMP_A_2(2GXQ)
?
[Raw transfer]




ADP_C_6(4PX9)
DDX3X_HUMAN
[Raw transfer]




ADP_A_4(4PX9)
DDX3X_HUMAN
[Raw transfer]




8OX_B_6(3MWL)
?
[Raw transfer]




AMP_A_8(2GXS)
?
[Raw transfer]




ADP_B_4(3FMO)
DD19B_HUMAN
[Raw transfer]




ADP_A_2(4PXA)
DDX3X_HUMAN
[Raw transfer]




8OD_A_5(3NBF)
?
[Raw transfer]




AMP_A_3(3IUY)
DDX53_HUMAN
[Raw transfer]




AMP_B_5(3IUY)
DDX53_HUMAN
[Raw transfer]




AMP_B_9(2GXS)
?
[Raw transfer]




8OD_D_13(3NBF)
?
[Raw transfer]




8OD_C_11(3NBF)
?
[Raw transfer]




8OD_A_6(3NBF)
?
[Raw transfer]




8OD_B_8(3NBF)
?
[Raw transfer]




FLC_C_3(1T6N)
DX39B_HUMAN
[Raw transfer]




FLC_D_4(1T6N)
DX39B_HUMAN
[Raw transfer]




TLA_B_4(1VEC)
DDX6_HUMAN
[Raw transfer]




12 PsiBlast_PDB 91.1135%-109 - C3 -2I4I - DDX3X_HUMAN -
122 HHSearch 90.5337%-107 - C3 -2I4I - DDX3X_HUMAN -
13 PsiBlast_PDB 88.1834% -96 - C3 -4PXA 4.2 DDX3X_HUMAN
21 PsiBlast_CBE 87.8636% -99 - C3 -2DB3 - VASA1_DROME -
114 HHSearch 87.6138% -99 - C3 -2DB3 - VASA1_DROME -
22 PsiBlast_CBE 87.5136% -98 - C3 -2DB3 - VASA1_DROME -
30 PsiBlast_CBE 87.3735%-122 - C3 -2VSX - IF4A_YEAST -
3 PsiBlast_PDB 87.3641% -95 - C3 -4D25 - ? -
2 PsiBlast_PDB 87.2236% -99 - C3 -2DB3 - VASA1_DROME -
4 PsiBlast_PDB 87.2041% -96 - C3 -4D26 - ? -
31 PsiBlast_CBE 87.0835%-122 - C3 -2VSO - IF4A_YEAST -
20 PsiBlast_PDB 87.0335%-122 - C3 -2VSX - IF4A_YEAST -
19 PsiBlast_PDB 87.0035%-121 - C3 -2VSO - IF4A_YEAST -
1 PsiBlast_PDB 86.9540%-108 - C3 -1HV8 - H669_METJA -
23 PsiBlast_CBE 86.9036%-100 - C3 -2DB3 - VASA1_DROME -
124 HHSearch 86.6540%-108 - C3 -1HV8 - H669_METJA -
10 PsiBlast_PDB 83.5034%-100 - C3 -2J0S - IF4A3_HUMAN -
7 PsiBlast_PDB 83.2434% -96 - C3 -2XB2 - IF4A3_HUMAN -
6 PsiBlast_PDB 82.8034%-100 - C3 -3EX7 - IF4A3_HUMAN -
25 PsiBlast_CBE 82.6134% -96 - C3 -2HYI - IF4A3_HUMAN -
51 PsiBlast_CBE 67.9838%-113 - C3 -3BER 5.6 DDX47_HUMAN
74 PsiBlast_CBE 67.1933%-123 - C3 -4PX9 5.8 DDX3X_HUMAN
73 PsiBlast_CBE 66.6633%-122 - C3 -4PX9 5.2 DDX3X_HUMAN
72 PsiBlast_CBE 65.5533%-123 - C3 -4PX9 5.5 DDX3X_HUMAN
57 PsiBlast_CBE 64.1142%-106 - C3 -2GXQ 6.2 ?
56 PsiBlast_CBE 63.4342%-106 - C3 -2GXS 6.0 ?
55 PsiBlast_CBE 63.3142%-101 - C3 -2GXS 4.9 ?
92 PsiBlast_CBE 63.1431%-115 - C3 -3FMO 6.3 DD19B_HUMAN
80 PsiBlast_CBE 63.0738%-118 - C3 -3IUY 4.3 DDX53_HUMAN
58 PsiBlast_CBE 63.0541%-110 - C3 -3NBF 5.8 ?
59 PsiBlast_CBE 62.8641%-104 - C3 -3NBF 5.5 ?
61 PsiBlast_CBE 62.7541% -99 - C3 -3NBF 5.5 ?
79 PsiBlast_CBE 62.6438%-121 - C3 -3IUY 4.8 DDX53_HUMAN
75 PsiBlast_CBE 62.6034%-110 - C3 -1VEC 2.7 DDX6_HUMAN
62 PsiBlast_CBE 62.5641%-107 - C3 -3MWL 3.8 ?
85 PsiBlast_CBE 62.4734%-108 - C3 -2OXC 6.4 DDX20_HUMAN
86 PsiBlast_CBE 62.3434%-103 - C3 -2OXC 7.0 DDX20_HUMAN
70 PsiBlast_CBE 61.9938%-100 - C3 -2PL3 6.0 DDX10_HUMAN
60 PsiBlast_CBE 61.6841% -96 - C3 -3NBF 6.0 ?
64 PsiBlast_CBE 61.4741%-101 - C3 -3MWK 4.3 ?
81 PsiBlast_CBE 61.1532%-105 - C3 -1T6N 2.8 DX39B_HUMAN
82 PsiBlast_CBE 60.5532%-103 - C3 -1T6N 2.7 DX39B_HUMAN