Study : Wbm0739 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C3_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C3_S1
Complex: EDO_A_4(4JGA) / Model_22(4JGA/B) = [3.1] Download369.2021.62MSRRVVVTGIGLITPLAADVENTWLKLINGKSGIKKISRFDASDLSCKVAGQVPLQHDNIEHCFNPLNYISEKDLKRTDRFIHYGIAAAIQAVDDSLILENQSINRERIGVAIGSGIGGLPSIQENVIIMQEKGPRRVSPFFVPASLINLISGHVSIKYEFTGPNDSAVTACATGAHAIINSARAIKLGEADVMIAGGSESALCRVGIAGFASMKALSTKFNDKPKEASRPWNEGRDGFVMGEGAGILVLEEYEHAKKRGAKIYAELTGYGLTGDAYHITAPHLEGRGALKAMQLALKSAQINPNQIGYINAHGTSTPLGDKIEVIAIKQLFDDYAYKIPISSTKSSIGHLLGAAGSVEAIFSILVLNNGIVPPTLNLHKPSEGCDLNFIPLKAQEHEIQYALSNSFGFGGTNASLVFGKCS
Complex: DAO_C_3(2GFY) / Model_17(2GFY/A) = [3.1] Download742.6724.45MSRRVVVTGIGLITPLAADVENTWLKLINGKSGIKKISRFDASDLSCKVAGQVPLQHDNIEHCFNPLNYISEKDLKRTDRFIHYGIAAAIQAVDDSLILENQSINRERIGVAIGSGIGGLPSIQENVIIMQEKGPRRVSPFFVPASLINLISGHVSIKYEFTGPNDSAVTACATGAHAIINSARAIKLGEADVMIAGGSESALCRVGIAGFASMKALSTKFNDKPKEASRPWNEGRDGFVMGEGAGILVLEEYEHAKKRGAKIYAELTGYGLTGDAYHITAPHLEGRGALKAMQLALKSAQINPNQIGYINAHGTSTPLGDKIEVIAIKQLFDDYAYKIPISSTKSSIGHLLGAAGSVEAIFSILVLNNGIVPPTLNLHKPSEGCDLNFIPLKAQEHEIQYALSNSFGFGGTNASLVFGKCS
Complex: EDO_B_14(4C6Z) / Model_76(4C6Z/B) = [3.3] Download406.4719.57MSRRVVVTGIGLITPLAADVENTWLKLINGKSGIKKISRFDASDLSCKVAGQVPLQHDNIEHCFNPLNYISEKDLKRTDRFIHYGIAAAIQAVDDSLILENQSINRERIGVAIGSGIGGLPSIQENVIIMQEKGPRRVSPFFVPASLINLISGHVSIKYEFTGPNDSAVTACATGAHAIINSARAIKLGEADVMIAGGSESALCRVGIAGFASMKALSTKFNDKPKEASRPWNEGRDGFVMGEGAGILVLEEYEHAKKRGAKIYAELTGYGLTGDAYHITAPHLEGRGALKAMQLALKSAQINPNQIGYINAHGTSTPLGDKIEVIAIKQLFDDYAYKIPISSTKSSIGHLLGAAGSVEAIFSILVLNNGIVPPTLNLHKPSEGCDLNFIPLKAQEHEIQYALSNSFGFGGTNASLVFGKCS
Complex: CER_A_3(1B3N) / Model_15(1B3N/A) = [3.4] Download714.8025.08MSRRVVVTGIGLITPLAADVENTWLKLINGKSGIKKISRFDASDLSCKVAGQVPLQHDNIEHCFNPLNYISEKDLKRTDRFIHYGIAAAIQAVDDSLILENQSINRERIGVAIGSGIGGLPSIQENVIIMQEKGPRRVSPFFVPASLINLISGHVSIKYEFTGPNDSAVTACATGAHAIINSARAIKLGEADVMIAGGSESALCRVGIAGFASMKALSTKFNDKPKEASRPWNEGRDGFVMGEGAGILVLEEYEHAKKRGAKIYAELTGYGLTGDAYHITAPHLEGRGALKAMQLALKSAQINPNQIGYINAHGTSTPLGDKIEVIAIKQLFDDYAYKIPISSTKSSIGHLLGAAGSVEAIFSILVLNNGIVPPTLNLHKPSEGCDLNFIPLKAQEHEIQYALSNSFGFGGTNASLVFGKCS
Complex: 1XG_B_10(4LS8) / Model_29(4LS8/B) = [3.5] Download951.5824.35MSRRVVVTGIGLITPLAADVENTWLKLINGKSGIKKISRFDASDLSCKVAGQVPLQHDNIEHCFNPLNYISEKDLKRTDRFIHYGIAAAIQAVDDSLILENQSINRERIGVAIGSGIGGLPSIQENVIIMQEKGPRRVSPFFVPASLINLISGHVSIKYEFTGPNDSAVTACATGAHAIINSARAIKLGEADVMIAGGSESALCRVGIAGFASMKALSTKFNDKPKEASRPWNEGRDGFVMGEGAGILVLEEYEHAKKRGAKIYAELTGYGLTGDAYHITAPHLEGRGALKAMQLALKSAQINPNQIGYINAHGTSTPLGDKIEVIAIKQLFDDYAYKIPISSTKSSIGHLLGAAGSVEAIFSILVLNNGIVPPTLNLHKPSEGCDLNFIPLKAQEHEIQYALSNSFGFGGTNASLVFGKCS
Consensus
[pKd Mean = 3.28]
-636
(s=219)
23
(s=2)
MSRRVVVTGIGLITPLAADVENTWLKLINGKSGIKKISRFDASDLSCKVAGQVPLQHDNIEHCFNPLNYISEKDLKRTDRFIHYGIAAAIQAVDDSLILENQSINRERIGVAIGSGIGGLPSIQENVIIMQEKGPRRVSPFFVPASLINLISGHVSIKYEFTGPNDSAVTACATGAHAIINSARAIKLGEADVMIAGGSESALCRVGIAGFASMKALSTKFNDKPKEASRPWNEGRDGFVMGEGAGILVLEEYEHAKKRGAKIYAELTGYGLTGDAYHITAPHLEGRGALKAMQLALKSAQINPNQIGYINAHGTSTPLGDKIEVIAIKQLFDDYAYKIPISSTKSSIGHLLGAAGSVEAIFSILVLNNGIVPPTLNLHKPSEGCDLNFIPLKAQEHEIQYALSNSFGFGGTNASLVFGKCS