@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0739: (2015-12-04 )
MSRRVVVTGIGLITPLAADVENTWLKLINGKSGIKKISRFDASDLSCKVAGQVPLQHDNIEHCFNPLNYISEKDLKRTDRFIHYGIAAAIQAVDDSLILENQSINRERIGVAIGSGIGGLPSIQENVIIMQEKGPRRVSPFFVPASLINLISGHVSIKYEFTGPNDSAVTACATGAHAIINSARAIKLGEADVMIAGGSESALCRVGIAGFASMKALSTKFNDKPKEASRPWNEGRDGFVMGEGAGILVLEEYEHAKKRGAKIYAELTGYGLTGDAYHITAPHLEGRGALKAMQLALKSAQINPNQIGYINAHGTSTPLGDKIEVIAIKQLFDDYAYKIPISSTKSSIGHLLGAAGSVEAIFSILVLNNGIVPPTLNLHKPSEGCDLNFIPLKAQEHEIQYALSNSFGFGGTNASLVFGKCS

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PMN_A_2(3HNZ)
FABF_ECOLI
[Raw transfer]




N3A_A_2(3HO9)
FABF_ECOLI
[Raw transfer]




PMN_C_3(2GFX)
FABF_ECOLI
[Raw transfer]




840_A_2(3I8P)
FABF_ECOLI
[Raw transfer]




1X9_A_6(4LS7)
FABF_BACSU
[Raw transfer]




P9A_A_2(3G0Y)
FABF_ECOLI
[Raw transfer]




1X9_B_10(4LS7)
FABF_BACSU
[Raw transfer]




N32_A_2(3HO2)
FABF_ECOLI
[Raw transfer]




P9C_A_2(3G11)
FABF_ECOLI
[Raw transfer]




1XG_A_3(4LS8)
FABF_BACSU
[Raw transfer]




CER_A_3(1B3N)
FABF_ECOLI
[Raw transfer]




1XG_B_10(4LS8)
FABF_BACSU
[Raw transfer]




GOL_A_6(4C70)
?
[Raw transfer]




GOL_B_10(4LS5)
FABF_BACSU
[Raw transfer]




TLG_A_4(4C6V)
?
[Raw transfer]




TLG_A_6(4C6U)
?
[Raw transfer]




GOL_B_9(4LS6)
FABF_BACSU
[Raw transfer]




7RD_B_15(4C71)
?
[Raw transfer]




TLM_A_9(2WGE)
FAB1_MYCTU
[Raw transfer]




TLH_B_23(4C73)
?
[Raw transfer]




TLG_A_15(4C72)
?
[Raw transfer]




TLG_B_25(4C72)
?
[Raw transfer]




TLH_A_13(4C73)
?
[Raw transfer]




6NA_B_5(2IWZ)
OXSM_HUMAN
[Raw transfer]




6NA_B_5(2IX4)
KASM_ARATH
[Raw transfer]




6NA_A_3(2IWZ)
OXSM_HUMAN
[Raw transfer]




6NA_A_3(2IX4)
KASM_ARATH
[Raw transfer]




DAO_C_3(2GFY)
FABF_ECOLI
[Raw transfer]




EDO_A_4(3KZU)
?
[Raw transfer]




EDO_A_4(4JGA)
?
[Raw transfer]




3MQ_A_5(3MQD)
?
[Raw transfer]




EDO_B_14(4C6Z)
?
[Raw transfer]




EDO_A_5(3KZU)
?
[Raw transfer]




IPA_A_5(2WGD)
FAB1_MYCTU
[Raw transfer]




EDO_A_8(4C6Z)
?
[Raw transfer]




IPA_B_13(4C70)
?
[Raw transfer]




106 HHSearch 97.7955% -75 - C3 -3KZU 3.0 ?
8 PsiBlast_PDB 97.6152% -79 - C3 -4JRM - FABF_VIBCH -
13 PsiBlast_PDB 97.6055% -75 - C3 -3KZU - ? -
7 PsiBlast_PDB 97.5552% -79 - C3 -4JRH - FABF_VIBCH -
14 PsiBlast_PDB 97.2954% -76 - C3 -2GFW - FABF_ECOLI -
4 PsiBlast_PDB 97.1253% -78 - C3 -4JPF - ? -
28 PsiBlast_CBE 97.0152% -79 - C3 -4JRH - FABF_VIBCH -
23 PsiBlast_CBE 96.9453% -77 - C3 -4B7V - ? -
1 PsiBlast_PDB 96.9057% -79 - C3 -4QAV - ? -
43 PsiBlast_CBE 96.8355% -76 - C3 -3E60 - ? -
16 PsiBlast_PDB 96.6954% -73 - C3 -1KAS - FABF_ECOLI -
3 PsiBlast_PDB 96.6853% -76 - C3 -4B7V - ? -
21 PsiBlast_CBE 96.6157% -78 - C3 -4QAV - ? -
33 PsiBlast_CBE 96.4155% -74 - C3 -3KZU - ? -
26 PsiBlast_CBE 96.3952% -79 - C3 -4JRM - FABF_VIBCH -
6 PsiBlast_PDB 96.1453% -76 - C3 -4JB6 - ? -
11 PsiBlast_PDB 95.9951% -77 - C3 -4LS8 3.8 FABF_BACSU
9 PsiBlast_PDB 95.9551% -78 - C3 -4LS5 - FABF_BACSU -
27 PsiBlast_CBE 95.8952% -79 - C3 -4JRM - FABF_VIBCH -
29 PsiBlast_CBE 95.8051% -76 - C3 -4LS8 3.5 FABF_BACSU
22 PsiBlast_CBE 95.7757% -77 - C3 -4JGA 3.1 ?
31 PsiBlast_CBE 95.6351% -77 - C3 -4LS5 2.7 FABF_BACSU
20 PsiBlast_PDB 95.6253% -76 - C3 -3HO9 6.4 FABF_ECOLI
19 PsiBlast_PDB 95.4853% -75 - C3 -3HO2 6.5 FABF_ECOLI
40 PsiBlast_CBE 95.4553% -75 - C3 -3G11 7.2 FABF_ECOLI
44 PsiBlast_CBE 95.4353% -75 - C3 -2GFX 6.9 FABF_ECOLI
34 PsiBlast_CBE 95.2855% -72 - C3 -3KZU 3.0 ?
15 PsiBlast_PDB 95.2054% -74 - C3 -1B3N 3.4 FABF_ECOLI
35 PsiBlast_CBE 95.1753% -75 - C3 -3I8P 6.6 FABF_ECOLI
37 PsiBlast_CBE 94.9551% -78 - C3 -2IX4 2.0 KASM_ARATH
10 PsiBlast_PDB 94.8751% -75 - C3 -4LS7 4.6 FABF_BACSU
41 PsiBlast_CBE 94.8453% -76 - C3 -3G0Y 6.7 FABF_ECOLI
17 PsiBlast_PDB 94.7453% -73 - C3 -2GFY 3.1 FABF_ECOLI
32 PsiBlast_CBE 94.5251% -75 - C3 -4LS6 2.2 FABF_BACSU
18 PsiBlast_PDB 94.4953% -73 - C3 -3HNZ 7.0 FABF_ECOLI
30 PsiBlast_CBE 94.2151% -74 - C3 -4LS7 4.9 FABF_BACSU
36 PsiBlast_CBE 94.1651% -79 - C3 -2IX4 2.1 KASM_ARATH
46 PsiBlast_CBE 91.5850% -71 - C3 -2IWZ 3.8 OXSM_HUMAN
45 PsiBlast_CBE 89.6550% -71 - C3 -2IWZ 2.7 OXSM_HUMAN
61 PsiBlast_CBE 86.3538% -72 - C3 -3MQD 2.1 ?
72 PsiBlast_CBE 84.1835% -65 - C3 -4C71 5.7 ?
66 PsiBlast_CBE 84.0735% -65 - C3 -2WGE 4.0 FAB1_MYCTU
71 PsiBlast_CBE 83.9735% -63 - C3 -4C72 5.3 ?
70 PsiBlast_CBE 83.9535% -64 - C3 -4C72 5.3 ?
74 PsiBlast_CBE 83.8835% -64 - C3 -4C70 2.7 ?
67 PsiBlast_CBE 83.8135% -66 - C3 -2WGD 2.5 FAB1_MYCTU
76 PsiBlast_CBE 83.6935% -64 - C3 -4C6Z 3.3 ?
69 PsiBlast_CBE 83.4035% -63 - C3 -4C73 5.3 ?
75 PsiBlast_CBE 83.2735% -63 - C3 -4C70 2.9 ?
68 PsiBlast_CBE 83.1635% -63 - C3 -4C73 5.3 ?
77 PsiBlast_CBE 83.1035% -63 - C3 -4C6Z 2.9 ?
65 PsiBlast_CBE 82.4735% -61 - C3 -4C6U 4.3 ?
64 PsiBlast_CBE 81.8735% -64 - C3 -4C6V 4.8 ?