@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0763: (2015-12-04 )
MNELRKLSIAQMHNGLKQRSFSAVELIEVHINAVENEKLNAFITKTPEIAIKAAKTADERFSQQKDSTISPLMGIPVGVKDLFCTKGVKTTACSKMLENFIPTYESTVSDLLLKSGAAMLGKLNMDEFAMGSANINSYFGPVENVWVRKSDGEKVVPGGSSGGSAASVAGFLCAGALGSDTGGSVRQPAAYCGVVGAKPTYGRCSRFGMIAFASSLDQAGVITRSVSDSALMLETICGYDNKDSTSSERPVPRFSNFINGDIKGRRIGIPKEYRMDGISEEIIYHWEKVSSDLKENGAEVVDITLPHTKYAIPVYYLICSAEASSNLARYDGVRYGLRVNADILEEMYSLTRAEGFGKEVKRRILIGAYALSSGHYNEYYEKAQCIRALIRNDFIKAFEKIDYILVPSAPTEAFGLNEKPDPLIMCINDVFTVPASLAGLPAISVPVGLSNEGLPLALQVIGNYYDEAGMLNVASVIEQNCSRIIKLNS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ASN_A_5(2DQN)
GATA_STAAM
[Raw transfer]




GLN_A_5(2F2A)
GATA_STAAM
[Raw transfer]




96 HHSearch 98.1050% -77 - C5 -3IP4 - GATA_STAAM -
4 PsiBlast_PDB 97.1548% -74 - C5 -3H0R - GATA_AQUAE -
2 PsiBlast_PDB 97.0248% -75 - C5 -3H0L - GATA_AQUAE -
34 PsiBlast_CBE 96.9648% -76 - C5 -3H0M - GATA_AQUAE -
3 PsiBlast_PDB 96.9548% -75 - C5 -3H0M - GATA_AQUAE -
6 PsiBlast_PDB 96.8050% -76 - C5 -2DQN 3.7 GATA_STAAM
9 PsiBlast_PDB 96.6750% -76 - C5 -3IP4 - GATA_STAAM -
27 PsiBlast_CBE 96.6548% -78 - C5 -3H0R - GATA_AQUAE -
97 HHSearch 96.2049% -77 - C5 -3H0L - GATA_AQUAE -
7 PsiBlast_PDB 95.9550% -74 - C5 -2G5H - GATA_STAAM -
5 PsiBlast_PDB 95.7450% -74 - C5 -2DF4 - GATA_STAAM -
10 PsiBlast_PDB 95.7350% -76 - C5 -2F2A 4.3 GATA_STAAM
1 PsiBlast_PDB 95.5048% -81 - C5 -4WJ3 - GATA_PSEAE -
8 PsiBlast_PDB 94.6750% -74 - C5 -2G5I - GATA_STAAM -
98 HHSearch 89.5242% -77 - C5 -3KFU - GATA_THET8 -
100 HHSearch 87.3343% -76 - C5 -2GI3 - GATA_THEMA -
13 PsiBlast_PDB 85.7243% -68 * C5 *3KFU - GATA_THET8 -
12 PsiBlast_PDB 83.4045% -69 - C5 -2GI3 - GATA_THEMA -
11 PsiBlast_PDB 81.5845% -68 - C5 -3AL0 - GATA_THEMA -
104 HHSearch 78.0328% -63 - C5 -3A1K - ? -