@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0801: (2015-12-04 )
MNINNRIGIYPGTFDPITFGHIDIIKRACKLVDRLIIGVAENINKHTTFDAKLRTSMAENEIKRLEIDVDVVSFNGLLVKFAKEQNASVIIRGLRAVSDFDYEFQMSWVNYKLLPEIETIFLPASEDTQFISSSFVKEIARLGESVSKFVSVGVQKELINLNRIGSE

Atome Classification :

(55 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COD_A_2(3PXU)
COAD_BURP1
[Raw transfer]




AGS_A_7(4NAH)
COAD_STAAW
[Raw transfer]




COA_A_2(3L92)
COAD_YERPE
[Raw transfer]




AGS_B_10(4NAH)
COAD_STAAW
[Raw transfer]




AGS_F_16(4NAH)
COAD_STAAW
[Raw transfer]




COD_J_10(1B6T)
COAD_ECOLI
[Raw transfer]




AGS_E_15(4NAH)
COAD_STAAW
[Raw transfer]




ATP_F_12(3ND6)
COAD_ENTFA
[Raw transfer]




ATP_C_9(3ND6)
COAD_ENTFA
[Raw transfer]




AGS_B_6(4NAU)
COAD_STAAW
[Raw transfer]




AGS_C_12(4NAH)
COAD_STAAW
[Raw transfer]




AGS_C_7(4NAU)
COAD_STAAW
[Raw transfer]




AGS_D_13(4NAH)
COAD_STAAW
[Raw transfer]




ATP_A_7(3ND6)
COAD_ENTFA
[Raw transfer]




ATP_A_4(1GN8)
COAD_ECOLI
[Raw transfer]




AGS_A_4(4NAU)
COAD_STAAW
[Raw transfer]




ATP_B_6(1GN8)
COAD_ECOLI
[Raw transfer]




ATP_D_10(3ND6)
COAD_ENTFA
[Raw transfer]




PPS_A_2(3F3M)
COAD_STAAW
[Raw transfer]




ADP_A_5(1O6B)
COAD_BACSU
[Raw transfer]




ADP_C_11(4NAT)
COAD_STAAW
[Raw transfer]




ADP_A_5(1O6B)
COAD_BACSU
[Raw transfer]




4PS_A_2(3K9W)
COAD_BURP1
[Raw transfer]




COA_A_7(1H1T)
COAD_ECOLI
[Raw transfer]




4PS_A_2(3K9W)
COAD_BURP1
[Raw transfer]




ADP_B_9(4NAT)
COAD_STAAW
[Raw transfer]




ADP_A_6(4NAT)
COAD_STAAW
[Raw transfer]




PNS_D_10(1VLH)
COAD_THEMA
[Raw transfer]




COA_D_8(3PNB)
COAD_MYCTU
[Raw transfer]




PNS_A_7(1VLH)
COAD_THEMA
[Raw transfer]




PNS_A_7(1VLH)
COAD_THEMA
[Raw transfer]




PNS_C_9(1VLH)
COAD_THEMA
[Raw transfer]




PNS_B_8(1VLH)
COAD_THEMA
[Raw transfer]




COA_B_6(3PNB)
COAD_MYCTU
[Raw transfer]




PNS_B_8(1H1T)
COAD_ECOLI
[Raw transfer]




PNS_E_11(1VLH)
COAD_THEMA
[Raw transfer]




COA_C_7(3PNB)
COAD_MYCTU
[Raw transfer]




PNS_B_22(1QJC)
COAD_ECOLI
[Raw transfer]




PNS_F_12(1VLH)
COAD_THEMA
[Raw transfer]




COA_A_5(3PNB)
COAD_MYCTU
[Raw transfer]




PNS_A_2(1OD6)
COAD_THET8
[Raw transfer]




PNS_A_5(3NBK)
COAD_MYCTU
[Raw transfer]




PNS_A_5(3NBK)
COAD_MYCTU
[Raw transfer]




PNS_A_2(1OD6)
COAD_THET8
[Raw transfer]




PNS_D_10(3NBK)
COAD_MYCTU
[Raw transfer]




PNS_B_7(3NBK)
COAD_MYCTU
[Raw transfer]




COA_A_2(3LCJ)
COAD_MYCTU
[Raw transfer]




COA_A_2(3RHS)
COAD_MYCTU
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




95 Fugue 95.4243%-120 - C3 -1B6T - COAD_ECOLI -
108 HHSearch 95.1844%-116 * C3 *1QJC - COAD_ECOLI -
3 PsiBlast_PDB 95.1645%-125 - C3 -1B6T - COAD_ECOLI -
27 PsiBlast_CBE 95.0146%-133 - C3 -1VLH 5.7 COAD_THEMA
6 PsiBlast_PDB 94.9545%-120 - C3 -1QJC - COAD_ECOLI -
5 PsiBlast_PDB 94.8845%-125 - C3 -1H1T 5.3 COAD_ECOLI
10 PsiBlast_PDB 94.5946%-132 - C3 -1VLH 5.4 COAD_THEMA
28 PsiBlast_CBE 94.4946%-134 - C3 -1VLH 5.4 COAD_THEMA
30 PsiBlast_CBE 93.9846%-133 - C3 -1VLH 5.0 COAD_THEMA
29 PsiBlast_CBE 93.6346%-135 - C3 -1VLH 5.4 COAD_THEMA
26 PsiBlast_CBE 93.4146%-131 - C3 -1VLH 4.7 COAD_THEMA
106 HHSearch 93.3843%-127 - C3 -1VLH 5.4 COAD_THEMA
21 PsiBlast_CBE 93.3345%-126 - C3 -1H1T 3.7 COAD_ECOLI
32 PsiBlast_CBE 93.2943%-120 - C3 -4NAU 7.3 COAD_STAAW
112 HHSearch 93.2141%-117 - C3 -1O6B 6.7 COAD_BACSU
96 Fugue 92.7443%-120 - C3 -1B6T - COAD_ECOLI -
22 PsiBlast_CBE 92.5045%-126 - C3 -1GN8 7.6 COAD_ECOLI
7 PsiBlast_PDB 92.4649%-123 - C3 -4F3R - COAD_COXBU -
4 PsiBlast_PDB 92.4445%-119 - C3 -1GN8 6.4 COAD_ECOLI
16 PsiBlast_PDB 92.2541%-120 - C3 -1O6B 6.7 COAD_BACSU
39 PsiBlast_CBE 91.9943%-115 - C3 -4NAH 7.0 COAD_STAAW
35 PsiBlast_CBE 91.9243%-117 - C3 -4NAH 6.6 COAD_STAAW
24 PsiBlast_CBE 91.8645%-124 - C3 -1QJC 4.6 COAD_ECOLI
109 HHSearch 91.7145%-121 - C3 -3K9W 5.2 COAD_BURP1
38 PsiBlast_CBE 91.6143%-116 - C3 -4NAH 6.1 COAD_STAAW
23 PsiBlast_CBE 91.4645%-119 - C3 -1B6T 9.5 COAD_ECOLI
12 PsiBlast_PDB 91.2243%-119 - C3 -4NAH 5.8 COAD_STAAW
15 PsiBlast_PDB 91.0043%-122 - C3 -3F3M 5.8 COAD_STAAW
8 PsiBlast_PDB 91.0042%-123 - C3 -3L92 7.0 COAD_YERPE
37 PsiBlast_CBE 90.9143%-119 - C3 -4NAH 5.3 COAD_STAAW
11 PsiBlast_PDB 90.5942%-131 - C3 -1OD6 3.7 COAD_THET8
13 PsiBlast_PDB 90.5243%-121 - C3 -4NAT 4.3 COAD_STAAW
105 HHSearch 90.5141%-125 - C3 -1OD6 3.7 COAD_THET8
31 PsiBlast_CBE 90.4043%-119 - C3 -4NAU 7.1 COAD_STAAW
14 PsiBlast_PDB 90.3343%-116 - C3 -4NAU 6.5 COAD_STAAW
34 PsiBlast_CBE 89.8943%-115 - C3 -4NAT 3.5 COAD_STAAW
33 PsiBlast_CBE 89.7743%-124 - C3 -4NAT 4.2 COAD_STAAW
1 PsiBlast_PDB 89.4748%-122 - C3 -3K9W 5.2 COAD_BURP1
36 PsiBlast_CBE 89.4643%-115 - C3 -4NAH 6.7 COAD_STAAW
2 PsiBlast_PDB 88.6348%-126 - C3 -3PXU 9.8 COAD_BURP1
111 HHSearch 85.6132%-116 - C3 -3NBK 3.4 COAD_MYCTU
75 PsiBlast_CBE 84.8034%-119 - C3 -3LCJ 3.2 COAD_MYCTU
53 PsiBlast_CBE 84.4837%-119 - C3 -3ND6 6.0 COAD_ENTFA
63 PsiBlast_CBE 83.7834%-119 - C3 -3NBK 3.3 COAD_MYCTU
60 PsiBlast_CBE 83.6834%-118 - C3 -3NBK 3.0 COAD_MYCTU
57 PsiBlast_CBE 83.1734%-115 - C3 -3PNB 5.4 COAD_MYCTU
58 PsiBlast_CBE 82.8734%-119 - C3 -3PNB 5.4 COAD_MYCTU
62 PsiBlast_CBE 82.6034%-116 - C3 -3NBK 3.5 COAD_MYCTU
51 PsiBlast_CBE 82.2237%-118 - C3 -3ND6 5.5 COAD_ENTFA
77 PsiBlast_CBE 81.4134%-116 - C3 -3RHS 3.0 COAD_MYCTU
54 PsiBlast_CBE 81.1437%-115 - C3 -3ND6 6.2 COAD_ENTFA
20 PsiBlast_PDB 80.8137%-113 - C3 -3ND6 6.2 COAD_ENTFA
56 PsiBlast_CBE 80.7234%-115 - C3 -3PNB 4.6 COAD_MYCTU
59 PsiBlast_CBE 80.3234%-120 - C3 -3PNB 5.4 COAD_MYCTU
110 HHSearch 77.6540%-133 - C3 -3NV7 3.5 COAD_HELPY