@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0804: (2015-12-04 )
MLNLESLPKHLAIIMDGNSRWANSQGRVKIDGYRKGSEVAYDIAKHCIALAIPYLTLYAFSMENWLRPKEETDCLFDLFYSILTDRDKVNFFHNYNIKLNFVGNLSLLPGKILNQIKESEEMTRKNDGLLLTVAVSYGAKQEIIHAVRNITRKNIDCVSEDEFEKFLYTKDLPKLDLLIRTGGEKRLSNFLLWQAAYAELYFCDTLWPDFSCQDLSKALEDYTKREKRYGR

Atome Classification :

(47 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

H78_A_3(3WYJ)
UPPS_ECOLI
[Raw transfer]




B75_A_3(2E9C)
UPPS_ECOLI
[Raw transfer]




B08_B_6(2E99)
UPPS_ECOLI
[Raw transfer]




B08_A_3(2E99)
UPPS_ECOLI
[Raw transfer]




B29_A_3(2E98)
UPPS_ECOLI
[Raw transfer]




GPP_A_6(2VG3)
DPDS_MYCTU
[Raw transfer]




FPS_C_3(1X08)
UPPS_ECOLI
[Raw transfer]




FPP_A_4(4Q9M)
ISPT_STRR6
[Raw transfer]




FPP_B_15(4Q9M)
ISPT_STRR6
[Raw transfer]




GPP_A_6(2VG3)
DPDS_MYCTU
[Raw transfer]




GPP_A_3(2VG0)
ZFPP_MYCTU
[Raw transfer]




B28_A_3(2E9A)
UPPS_ECOLI
[Raw transfer]




GPP_A_3(2VG0)
ZFPP_MYCTU
[Raw transfer]




FPS_A_4(1X06)
UPPS_ECOLI
[Raw transfer]




GPP_D_19(2VG3)
DPDS_MYCTU
[Raw transfer]




FPP_C_3(1V7U)
UPPS_ECOLI
[Raw transfer]




B75_B_5(2E9C)
UPPS_ECOLI
[Raw transfer]




B76_A_3(2E9D)
UPPS_ECOLI
[Raw transfer]




FPP_A_3(4H8E)
ISPT_STAAN
[Raw transfer]




GPP_B_9(2VG3)
DPDS_MYCTU
[Raw transfer]




FPS_A_3(4U82)
ISPT_STAAN
[Raw transfer]




TH9_B_3(3TH8)
UPPS_ECOLI
[Raw transfer]




B29_B_7(2E98)
UPPS_ECOLI
[Raw transfer]




40B_B_4(4ONC)
DPDS_MYCTU
[Raw transfer]




DPO_A_5(2VG2)
DPDS_MYCTU
[Raw transfer]




IPE_A_4(1X07)
UPPS_ECOLI
[Raw transfer]




2BJ_A_5(3SGV)
UPPS_ECOLI
[Raw transfer]




GPP_C_15(2VG3)
DPDS_MYCTU
[Raw transfer]




DPO_C_20(2VG2)
DPDS_MYCTU
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




IPE_A_3(1X09)
UPPS_ECOLI
[Raw transfer]




DPO_C_3(2DTN)
ISPT_HELPY
[Raw transfer]




B28_B_5(2E9A)
UPPS_ECOLI
[Raw transfer]




GOL_B_19(2VG2)
DPDS_MYCTU
[Raw transfer]




FPP_B_11(2VG1)
ZFPP_MYCTU
[Raw transfer]




IPE_A_4(1X09)
UPPS_ECOLI
[Raw transfer]




40B_A_3(4ONC)
DPDS_MYCTU
[Raw transfer]




B29_A_5(2E98)
UPPS_ECOLI
[Raw transfer]




FFT_B_3(3UGS)
ISPT_CAMJE
[Raw transfer]




B08_A_5(2E99)
UPPS_ECOLI
[Raw transfer]




FFT_A_4(3UGS)
ISPT_CAMJE
[Raw transfer]




IPE_B_15(2VG2)
DPDS_MYCTU
[Raw transfer]




IPE_A_6(2VG2)
DPDS_MYCTU
[Raw transfer]




FFT_B_3(3UGS)
ISPT_CAMJE
[Raw transfer]




4 PsiBlast_PDB 97.6241%-114 - C10 -1X07 4.9 UPPS_ECOLI
3 PsiBlast_PDB 96.2041%-110 - C10 -1X06 7.4 UPPS_ECOLI
95 HHSearch 96.1040%-114 - C10 -2VG3 7.1 DPDS_MYCTU
2 PsiBlast_PDB 96.0841%-116 - C10 -1V7U 5.8 UPPS_ECOLI
31 PsiBlast_CBE 95.7741%-114 - C10 -2E9D - UPPS_ECOLI -
40 PsiBlast_CBE 95.5540%-109 - C10 -1X08 6.9 UPPS_ECOLI
37 PsiBlast_CBE 95.5341%-112 - C10 -1UEH - UPPS_ECOLI -
39 PsiBlast_CBE 95.5040%-110 - C10 -1X09 5.0 UPPS_ECOLI
13 PsiBlast_PDB 95.1741%-117 - C10 -3SGV 6.1 UPPS_ECOLI
12 PsiBlast_PDB 95.0441%-114 - C10 -3SGT - UPPS_ECOL6 -
35 PsiBlast_CBE 94.9341%-115 - C10 -2E98 5.7 UPPS_ECOLI
27 PsiBlast_CBE 94.7641%-117 - C10 -3WYJ 9.4 UPPS_ECOLI
92 HHSearch 94.5542%-115 * C10 *3SGV 6.4 UPPS_ECOLI
51 PsiBlast_CBE 94.4039%-100 - C10 -2VG3 6.7 DPDS_MYCTU
1 PsiBlast_PDB 94.3841%-119 - C10 -1UEH - UPPS_ECOLI -
16 PsiBlast_PDB 94.2341%-111 - C10 -4H2J - UPPS_ECOLI -
30 PsiBlast_CBE 94.1641%-112 - C10 -3SGV 6.3 UPPS_ECOLI
34 PsiBlast_CBE 94.1541%-115 - C10 -2E99 5.2 UPPS_ECOLI
25 PsiBlast_CBE 94.1141%-113 - C10 -4H2M - UPPS_ECOLI -
6 PsiBlast_PDB 94.0841%-110 - C10 -2E99 7.1 UPPS_ECOLI
52 PsiBlast_CBE 93.9239% -98 - C10 -2VG3 7.2 DPDS_MYCTU
53 PsiBlast_CBE 93.8439% -99 - C10 -2VG2 2.6 DPDS_MYCTU
47 PsiBlast_CBE 93.8439% -99 - C10 -4ONC 4.0 DPDS_MYCTU
5 PsiBlast_PDB 93.7941%-111 - C10 -2E98 7.4 UPPS_ECOLI
49 PsiBlast_CBE 93.7639%-101 - C10 -2VG3 6.3 DPDS_MYCTU
56 PsiBlast_CBE 93.7139% -97 - C10 -2VG2 4.1 DPDS_MYCTU
54 PsiBlast_CBE 93.6839% -94 - C10 -2VG2 3.6 DPDS_MYCTU
48 PsiBlast_CBE 93.5939% -95 - C10 -4ONC 5.3 DPDS_MYCTU
33 PsiBlast_CBE 93.3941%-117 - C10 -2E9A 3.4 UPPS_ECOLI
9 PsiBlast_PDB 93.2041%-113 - C10 -2E9D 5.0 UPPS_ECOLI
50 PsiBlast_CBE 93.1439% -94 - C10 -2VG3 7.1 DPDS_MYCTU
7 PsiBlast_PDB 93.0241%-111 - C10 -2E9A 4.9 UPPS_ECOLI
55 PsiBlast_CBE 92.9739%-100 - C10 -2VG2 4.2 DPDS_MYCTU
45 PsiBlast_CBE 92.5938%-111 - C10 -4Q9M 7.9 ISPT_STRR6
32 PsiBlast_CBE 92.4441%-115 - C10 -2E9C 5.5 UPPS_ECOLI
46 PsiBlast_CBE 92.3038%-107 - C10 -4Q9M 7.9 ISPT_STRR6
58 PsiBlast_CBE 90.8936%-102 - C10 -4H8E 8.3 ISPT_STAAN
57 PsiBlast_CBE 90.7636%-103 - C10 -4U82 7.7 ISPT_STAAN
97 HHSearch 90.5436%-112 - C10 -2VG0 5.9 ZFPP_MYCTU
28 PsiBlast_CBE 90.4041%-109 - C10 -3TH8 5.4 UPPS_ECOLI
60 PsiBlast_CBE 90.2940%-101 - C10 -2DTN 4.4 ISPT_HELPY
8 PsiBlast_PDB 90.1941%-109 - C10 -2E9C 5.7 UPPS_ECOLI
67 PsiBlast_CBE 88.9233%-117 - C10 -2VG1 6.4 ZFPP_MYCTU
64 PsiBlast_CBE 88.3733%-113 - C10 -2VG0 5.9 ZFPP_MYCTU
61 PsiBlast_CBE 87.0238%-112 - C10 -3UGS 5.5 ISPT_CAMJE
62 PsiBlast_CBE 86.3838%-116 - C10 -3UGS 5.8 ISPT_CAMJE
93 HHSearch 85.6538%-114 - C10 -3UGS 5.5 ISPT_CAMJE