@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0001: (2016-03-11 )
MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_8(2Z4R)
DNAA_THEMA
[Raw transfer]




ADP_A_7(2Z4R)
DNAA_THEMA
[Raw transfer]




ADP_C_9(2Z4R)
DNAA_THEMA
[Raw transfer]




ADP_A_3(1L8Q)
DNAA_AQUAE
[Raw transfer]




ADP_A_3(1L8Q)
DNAA_AQUAE
[Raw transfer]




ADP_A_3(1L8Q)
DNAA_AQUAE
[Raw transfer]




ADP_A_3(2Z4S)
DNAA_THEMA
[Raw transfer]




ADP_A_3(2Z4S)
DNAA_THEMA
[Raw transfer]




42 HHSearch 94.3837% -79 - C2 -1L8Q 7.9 DNAA_AQUAE
26 PsiBlast_CBE 93.2335% -80 - C2 -3R8F - DNAA_AQUAE -
31 Fugue 93.0636% -84 - C2 -1L8Q 7.9 DNAA_AQUAE
5 PsiBlast_PDB 93.0135% -83 - C2 -1L8Q 7.9 DNAA_AQUAE
4 PsiBlast_PDB 92.1135% -79 - C2 -3R8F - DNAA_AQUAE -
27 PsiBlast_CBE 91.9435% -79 - C2 -3R8F - DNAA_AQUAE -
28 PsiBlast_CBE 91.8835% -77 - C2 -3R8F - DNAA_AQUAE -
24 PsiBlast_CBE 90.4235% -75 - C2 -2HCB - DNAA_AQUAE -
23 PsiBlast_CBE 90.2235% -75 - C2 -2HCB - DNAA_AQUAE -
25 PsiBlast_CBE 89.9835% -74 - C2 -2HCB - DNAA_AQUAE -
1 PsiBlast_PDB 89.1335% -93 - C2 -2Z4R 7.0 DNAA_THEMA
22 PsiBlast_CBE 88.8735% -93 - C2 -2Z4R 7.3 DNAA_THEMA
21 PsiBlast_CBE 88.7635% -92 - C2 -2Z4R 7.1 DNAA_THEMA
3 PsiBlast_PDB 88.7535% -76 - C2 -2HCB - DNAA_AQUAE -
2 PsiBlast_PDB 88.1535% -91 - C2 -2Z4S 7.2 DNAA_THEMA
41 HHSearch 87.8135% -91 - C2 -2Z4S 7.2 DNAA_THEMA
45 HHSearch 61.5622% -67 - C2 -1HQC - RUVB_THET8 -
44 HHSearch 60.1020% -77 * C2 *3PFI - ? -
56 HHSearch 59.6220% -62 - C2 -1IY2 - FTSH_THET8 -
10 PsiBlast_PDB 58.9922% -60 - C2 -3BOS - ? -