@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0016: (2016-03-11 )
MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTSVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELW

Atome Classification :

(42 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

RPD_A_5(1QF4)
PURA_ECOLI
[Raw transfer]




2SA_A_5(1MEZ)
PURA1_MOUSE
[Raw transfer]




DOI_A_3(2DGN)
PURA1_MOUSE
[Raw transfer]




DOI_A_3(2GCQ)
PURA_ECOLI
[Raw transfer]




RPL_A_5(1QF5)
PURA_ECOLI
[Raw transfer]




IMP_C_3(1KJX)
PURA_ECOLI
[Raw transfer]




RPL_A_5(1QF5)
PURA_ECOLI
[Raw transfer]




IMP_A_8(1IWE)
PURA1_MOUSE
[Raw transfer]




AMP_A_3(4M9D)
PURA_BACAN
[Raw transfer]




IMP_A_5(1KKF)
PURA_ECOLI
[Raw transfer]




IMP_E_5(1KKB)
PURA_ECOLI
[Raw transfer]




AMP_C_3(1SON)
PURA_ECOLI
[Raw transfer]




AMP_E_5(1MF1)
PURA1_MOUSE
[Raw transfer]




H5P_A_6(1SOO)
PURA_ECOLI
[Raw transfer]




GDP_A_6(1P9B)
PURA_PLAFA
[Raw transfer]




GDP_A_5(1CG0)
PURA_ECOLI
[Raw transfer]




GDP_A_4(2GCQ)
PURA_ECOLI
[Raw transfer]




GDP_D_4(1DJ3)
PURA_WHEAT
[Raw transfer]




GDP_A_5(1MF0)
PURA1_MOUSE
[Raw transfer]




GDP_A_6(1P9B)
PURA_PLAFA
[Raw transfer]




GDP_A_6(1LNY)
PURA1_MOUSE
[Raw transfer]




GDP_A_4(1CIB)
PURA_ECOLI
[Raw transfer]




GPX_A_4(1CH8)
PURA_ECOLI
[Raw transfer]




GDP_A_5(1LON)
PURA1_MOUSE
[Raw transfer]




GDP_C_3(1DJ3)
PURA_WHEAT
[Raw transfer]




GDP_A_4(1CG4)
PURA_ECOLI
[Raw transfer]




GDP_A_5(1CG1)
PURA_ECOLI
[Raw transfer]




GDP_A_4(2DGN)
PURA1_MOUSE
[Raw transfer]




DPO_A_3(1KKF)
PURA_ECOLI
[Raw transfer]




GDP_D_4(1DJ2)
PURA_ARATH
[Raw transfer]




GDP_B_7(1LNY)
PURA1_MOUSE
[Raw transfer]




GDP_A_5(1CG3)
PURA_ECOLI
[Raw transfer]




GDP_C_3(1DJ2)
PURA_ARATH
[Raw transfer]




GTP_C_3(1LOO)
PURA1_MOUSE
[Raw transfer]




GDP_C_3(1DJ2)
PURA_ARATH
[Raw transfer]




GCP_B_4(1HOP)
PURA_ECOLI
[Raw transfer]




IMP_B_7(1IWE)
PURA1_MOUSE
[Raw transfer]




HAD_C_3(1KKB)
PURA_ECOLI
[Raw transfer]




GDP_A_2(2V40)
PURA2_HUMAN
[Raw transfer]




GDP_A_2(2V40)
PURA2_HUMAN
[Raw transfer]




CIT_A_2(3R7T)
PURA_CAMJE
[Raw transfer]




2 PsiBlast_PDB 94.4870% -79 - C3 -4M9D 6.6 PURA_BACAN
1 PsiBlast_PDB 93.7370% -87 - C3 -4M0G - PURA_BACAN -
4 PsiBlast_PDB 85.3146% -66 - C3 -1CH8 7.1 PURA_ECOLI
16 PsiBlast_PDB 85.2346% -70 - C3 -1CG1 6.9 PURA_ECOLI
54 Fugue 85.0747% -74 * C3 *1QF5 6.8 PURA_ECOLI
8 PsiBlast_PDB 84.9946% -67 - C3 -2GCQ 8.5 PURA_ECOLI
11 PsiBlast_PDB 84.7346% -76 - C3 -1ADE - PURA_ECOLI -
55 Fugue 84.6346% -78 - C3 -1ADE - PURA_ECOLI -
7 PsiBlast_PDB 84.5546% -68 - C3 -1CIB 6.7 PURA_ECOLI
6 PsiBlast_PDB 84.5046% -71 - C3 -1QF5 6.8 PURA_ECOLI
3 PsiBlast_PDB 84.4346% -66 - C3 -1CG0 7.5 PURA_ECOLI
10 PsiBlast_PDB 84.3446% -71 - C3 -1SOO 5.2 PURA_ECOLI
18 PsiBlast_PDB 84.3246% -68 - C3 -1CG3 7.3 PURA_ECOLI
13 PsiBlast_PDB 84.3046% -68 - C3 -1KJX 5.5 PURA_ECOLI
17 PsiBlast_PDB 84.2846% -75 - C3 -3HID - PURA_YERPE -
15 PsiBlast_PDB 84.2346% -67 - C3 -1KKF 7.1 PURA_ECOLI
19 PsiBlast_PDB 84.1346% -68 - C3 -1CG4 7.4 PURA_ECOLI
14 PsiBlast_PDB 83.8546% -68 - C3 -1KKB 6.6 PURA_ECOLI
9 PsiBlast_PDB 83.8546% -69 - C3 -1SON 5.4 PURA_ECOLI
42 HHSearch 83.8046% -74 - C3 -3HID - PURA_YERPE -
5 PsiBlast_PDB 83.7146% -71 - C3 -1QF4 7.4 PURA_ECOLI
21 PsiBlast_CBE 83.6946% -77 - C3 -1HOP 5.6 PURA_ECOLI
44 HHSearch 83.2944% -76 - C3 -1DJ2 6.3 PURA_ARATH
20 PsiBlast_PDB 82.6144% -73 - C3 -1DJ3 6.1 PURA_WHEAT
24 PsiBlast_CBE 82.2344% -73 - C3 -1DJ3 6.4 PURA_WHEAT
26 PsiBlast_CBE 81.9645% -76 - C3 -1DJ2 6.3 PURA_ARATH
25 PsiBlast_CBE 81.6545% -74 - C3 -1DJ2 5.8 PURA_ARATH
38 PsiBlast_CBE 80.2940% -84 - C3 -2V40 5.6 PURA2_HUMAN
35 PsiBlast_CBE 80.1740% -71 - C3 -1IWE 5.8 PURA1_MOUSE
45 HHSearch 80.0344% -75 - C3 -3R7T 3.3 PURA_CAMJE
33 PsiBlast_CBE 79.8540% -70 - C3 -1LNY 6.4 PURA1_MOUSE
41 HHSearch 79.7440% -83 - C3 -2V40 5.6 PURA2_HUMAN
34 PsiBlast_CBE 79.6140% -69 - C3 -1LNY 6.2 PURA1_MOUSE
36 PsiBlast_CBE 79.1840% -69 - C3 -1IWE 6.2 PURA1_MOUSE
27 PsiBlast_CBE 79.1240% -71 - C3 -2DGN 7.8 PURA1_MOUSE
32 PsiBlast_CBE 79.0240% -68 - C3 -1LON 6.1 PURA1_MOUSE
37 PsiBlast_CBE 78.8937% -71 - C3 -1P9B 6.9 PURA_PLAFA
46 HHSearch 78.8337% -67 - C3 -1P9B 6.9 PURA_PLAFA
30 PsiBlast_CBE 78.7440% -69 - C3 -1MEZ 7.1 PURA1_MOUSE
31 PsiBlast_CBE 78.6640% -72 - C3 -1LOO 5.5 PURA1_MOUSE
29 PsiBlast_CBE 78.5540% -67 - C3 -1MF0 5.8 PURA1_MOUSE
28 PsiBlast_CBE 78.3540% -69 - C3 -1MF1 5.6 PURA1_MOUSE