@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0040: (2016-03-11 )
MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_D_2(1SAX)
MECI_STAAN
[Raw transfer]

-

NACID_F_2(2D45)
MECI_STAAN
[Raw transfer]

-

NACID_B_1(1XSD)
BLAI_STAAU
[Raw transfer]

-

NACID_D_2(1SAX)
MECI_STAAN
[Raw transfer]

-

21 PsiBlast_CBE 95.97100%-124 - C3 -1SAX 3.1 MECI_STAAN
2 PsiBlast_PDB 95.76100%-120 - C3 -1SAX 5.7 MECI_STAAN
3 PsiBlast_PDB 95.6499%-124 - C3 -1SD6 - MECI_STAAN -
43 Fugue 92.90100%-118 - C3 -1OKR - MECI_STAAN -
1 PsiBlast_PDB 92.90100%-118 - C3 -1OKR - MECI_STAAN -
5 PsiBlast_PDB 90.6397%-115 - C3 -2D45 3.0 MECI_STAAN
24 HHSearch 88.5493%-119 - C3 -1OKR - MECI_STAAN -
23 HHSearch 84.5861%-124 - C3 -1SD4 - BLAI_STAAU -
7 PsiBlast_PDB 83.7960%-124 - C3 -1SD4 - BLAI_STAAU -
22 PsiBlast_CBE 83.55100% -27 - C- -1OKR - MECI_STAAN -
6 PsiBlast_PDB 82.2161%-116 - C3 -1XSD 3.4 BLAI_STAAU
9 PsiBlast_PDB 64.3841%-119 - C3 -2P7C - BLAI_BACLI -
8 PsiBlast_PDB 63.7541%-101 - C3 -1P6R - BLAI_BACLI -
27 HHSearch 62.6612% -99 - C3 -3BJ6 - ? -
42 HHSearch 62.2018%-116 - C3 -2FA5 - ? -
32 HHSearch 60.5516%-109 * C3 *1JGS - MARR_ECOLI -
28 HHSearch 60.2816%-103 - C3 -2GXG - ? -
39 HHSearch 59.7613%-113 - C3 -2FBH - ? -
25 HHSearch 57.9519% -91 - C3 -2G9W - BLAI_MYCTU -
15 PsiBlast_PDB 56.6821% -92 - C3 -2BV6 - MGRA_STAAU -