@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0043: (2016-03-11 )
MFFKQFYEDNFSQASYLIGCQRTGEAMIIDPIRDLTKYLKVADKEGFTITKAAETHIHADFASGIRDVANKLNASIYVSDEGKDEFNYKNMPKQTHFVKHQDIIYLGKIKLEVLHTPGHPPESISFLLTDEGGGSSIPMGLFSGDFIFVGDVGRPDLLEKAVNVEGSTKIGAKQMYQSIQFAATLPDYIQIWPGHGAGSPCGKALGSLPTTTLGYEKINNWAFNVKDETSFIETLTLNQPAPPHHFSQMKKINQFGMQMYQPYNVYPSSSNTQTAFDLRSKEAFHGGHMHGTINIPFNKTFINQIGWYLDYD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_A_5(2P18)
?
[Raw transfer]




22 PsiBlast_CBE 92.7174% -87 - C1 -3R2U - ? -
1 PsiBlast_PDB 91.6174% -87 - C1 -3R2U - ? -
49 Fugue 91.3874% -87 - C1 -3R2U - ? -
23 PsiBlast_CBE 90.8074% -91 * C1 *3R2U - ? -
21 PsiBlast_CBE 89.9174% -83 - C1 -3R2U - ? -
27 HHSearch 87.1373% -81 - C1 -3R2U - ? -
2 PsiBlast_PDB 73.2143% -73 - C1 -3TP9 - ? -
28 HHSearch 71.8545% -70 - C1 -3TP9 - ? -
3 PsiBlast_PDB 61.8628% -87 - C1 -4YSB - ? -
51 Fugue 57.3622% -66 - C1 -1QH5 - GLO2_HUMAN -
32 HHSearch 54.5725% -83 - C1 -2ZWR - ? -
30 HHSearch 54.5230% -72 - C1 -2XF4 - ? -
4 PsiBlast_PDB 54.4729% -59 - C1 -2XF4 - ? -
33 HHSearch 54.2627% -78 - C1 -1QH5 - GLO2_HUMAN -
53 Fugue 54.0721% -62 - C1 -4EFZ - Y2304_BURP1 -
12 PsiBlast_PDB 52.4025% -82 - C1 -1XM8 - GLO2N_ARATH -
13 PsiBlast_PDB 51.8525% -80 - C1 -2Q42 - GLO2N_ARATH -
11 PsiBlast_PDB 51.5722% -63 - C1 -4YSK - ? -
9 PsiBlast_PDB 51.3327% -70 - C1 -2ZWR - ? -
8 PsiBlast_PDB 50.3227% -71 - C1 -1QH5 - GLO2_HUMAN -