@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0160: (2016-03-12 )
MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COH_A_5(2ZDP)
HDOX2_STAAN
[Raw transfer]




COH_B_6(2ZDP)
HDOX2_STAAN
[Raw transfer]




HEM_B_4(3LGM)
HDOX2_STAAN
[Raw transfer]




HEM_B_5(3QGP)
HDOX2_STAAN
[Raw transfer]




HEM_B_5(3LGN)
HDOX2_STAAN
[Raw transfer]




HEM_A_3(3LGM)
HDOX2_STAAN
[Raw transfer]




HEM_A_3(3LGN)
HDOX2_STAAN
[Raw transfer]




HEM_A_3(3QGP)
HDOX2_STAAN
[Raw transfer]




HEM_A_3(4FNI)
HDOX2_STAAN
[Raw transfer]




HEM_B_5(4FNI)
HDOX2_STAAN
[Raw transfer]




HEM_B_4(4FNH)
HDOX2_STAAN
[Raw transfer]




HEM_A_3(4FNH)
HDOX2_STAAN
[Raw transfer]




HEM_D_8(2ZDO)
HDOX1_STAAN
[Raw transfer]




HEM_A_5(2ZDO)
HDOX1_STAAN
[Raw transfer]




HEM_B_6(2ZDO)
HDOX1_STAAN
[Raw transfer]




HEM_C_7(2ZDO)
HDOX1_STAAN
[Raw transfer]




4 PsiBlast_PDB 98.10100% -72 - C5 -3QGP 12.8 HDOX2_STAAN
22 PsiBlast_CBE 97.66100% -67 - C5 -3LGN 13.1 HDOX2_STAAN
21 PsiBlast_CBE 97.56100% -69 - C5 -3QGP 13.0 HDOX2_STAAN
24 PsiBlast_CBE 97.20100% -74 - C5 -2ZDP 12.5 HDOX2_STAAN
7 PsiBlast_PDB 97.1399% -72 - C5 -4FNI 12.9 HDOX2_STAAN
1 PsiBlast_PDB 97.03100% -68 - C5 -2ZDP 12.6 HDOX2_STAAN
3 PsiBlast_PDB 96.83100% -67 - C5 -3LGN 13.1 HDOX2_STAAN
6 PsiBlast_PDB 96.6599% -74 - C5 -4FNH 12.5 HDOX2_STAAN
25 PsiBlast_CBE 96.2199% -66 - C5 -4FNI 13.1 HDOX2_STAAN
2 PsiBlast_PDB 95.94100% -70 - C5 -3LGM 13.0 HDOX2_STAAN
23 PsiBlast_CBE 95.19100% -65 - C5 -3LGM 12.9 HDOX2_STAAN
26 PsiBlast_CBE 93.8499% -71 - C5 -4FNH 12.1 HDOX2_STAAN
5 PsiBlast_PDB 91.44100% -78 - C5 -1SQE - HDOX2_STAAM -
29 PsiBlast_CBE 81.2263% -65 - C5 -2ZDO 12.3 HDOX1_STAAN
8 PsiBlast_PDB 80.6263% -61 - C5 -2ZDO 12.5 HDOX1_STAAN
27 PsiBlast_CBE 80.5463% -62 - C5 -2ZDO 12.6 HDOX1_STAAN
28 PsiBlast_CBE 79.5363% -61 - C5 -2ZDO 12.1 HDOX1_STAAN
30 PsiBlast_CBE 65.7233% -76 - C5 -1IUJ - ? -
11 PsiBlast_PDB 63.4833% -64 - C5 -1IUJ - ? -
43 HHSearch 62.4427% -45 - C5 -1IUJ - ? -