@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0207: (2016-03-13 )
MSKILKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNSKDKPNQLTMWVDGDKQMAFYKKITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEIKLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVEANAAKLTDSKKKQYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIHQLGLNSKHVVKNAERLQKWYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETFGKDLGVTTLPTDGGKPMKPFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEMSEITGRVDVKSSNPNLKVFEKQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNPKQALDEATNDITQNIKILHPSQNDKKGD

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MAL_A_8(4HW8)
?
[Raw transfer]




MAL_B_18(4HW8)
?
[Raw transfer]




SUGAR_A_2(2ZYO)
?
[Raw transfer]

-

SUGAR_A_2(2ZYO)
?
[Raw transfer]

-

MAL_A_2(1URG)
?
[Raw transfer]




P33_B_7(4HS7)
?
[Raw transfer]




P33_A_4(4HS7)
?
[Raw transfer]




22 PsiBlast_CBE 95.8999% -80 - C1 -4HS7 3.6 ?
2 PsiBlast_PDB 94.6999% -78 - C1 -4HW8 3.5 ?
21 PsiBlast_CBE 94.5999% -79 - C1 -4HW8 3.1 ?
1 PsiBlast_PDB 92.7999% -78 - C1 -4HS7 3.6 ?
6 PsiBlast_PDB 70.0937% -63 - C1 -2ZYO 3.6 ?
3 PsiBlast_PDB 69.1137% -64 - C1 -2ZYK - ? -
26 HHSearch 67.3439% -62 - C1 -2ZYO 3.6 ?
24 PsiBlast_CBE 67.2737% -63 - C1 -2ZYK - ? -
7 PsiBlast_PDB 66.4232% -71 - C1 -2FNC - ? -
23 PsiBlast_CBE 64.5537% -62 - C1 -2ZYK - ? -
5 PsiBlast_PDB 63.5237% -65 - C1 -2ZYN - ? -
8 PsiBlast_PDB 62.4030% -66 - C1 -2GHA - ? -
4 PsiBlast_PDB 62.2237% -63 - C1 -2ZYM - ? -
52 Fugue 61.8726% -52 - C1 -2VGQ - MALE_ECOLI (first) -
32 HHSearch 61.1131% -61 - C1 -2GHA - ? -
55 Fugue 60.6827% -56 - C1 -4EXK - MALE_ECOLI -
50 Fugue 60.5126% -55 - C1 -3PY7 - MALE_ECOLI (first) -
49 Fugue 60.4927% -54 - C1 -3D4G - ZP3_MOUSE -
45 HHSearch 60.2627% -58 - C1 -3O3U - MALE_ECOLI (first) -
25 PsiBlast_CBE 60.1437% -63 - C1 -2ZYK - ? -
11 PsiBlast_PDB 41.5230% -56 - C1 -1URG 4.1 ?