@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0265: (2016-03-13 )
MKKLTAAAIATMGFATFTMAHQADAAETTNTQQAHTLMSTQSQDVSYGTYYTIDSNGDYHHTPDGNWNQAMFDNKEYSYTFVDAQGHTHYFYNCYPKNANANGSGQTYVNPATAGDNNDYTASQSQQHINQYGYQSNVGPDASYYSHSNNNQAYNSHDGNGKVNYPNGTSNQNGGSASKATASGHAKDASWLTSRKQLQPYGQYHGGGAHYGVDYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIGNQYAVDPTSYLQSR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TLA_B_6(2B13)

[Raw transfer]




TLA_A_5(2B13)
LYTM_STAA8
[Raw transfer]




48 Fugue 96.70100% -46 - C6 -1QWY - LYTM_STAA8 -
27 HHSearch 96.23100% -46 - C6 -1QWY - LYTM_STAA8 -
1 PsiBlast_PDB 96.0299% -46 - C6 -1QWY - LYTM_STAA8 -
18 PsiBlast_CBE 77.40100% -60 - C6 -2B13 3.3
19 PsiBlast_CBE 77.18100% -65 - C6 -2B0P - -
17 PsiBlast_CBE 76.99100% -61 - C6 -2B44 - -
4 PsiBlast_PDB 76.94100% -60 - C6 -2B13 4.3 LYTM_STAA8
3 PsiBlast_PDB 76.72100% -62 - C6 -2B0P - LYTM_STAA8 -
2 PsiBlast_PDB 76.70100% -63 - C6 -2B44 - LYTM_STAA8 -
24 PsiBlast_CBE 71.1548% -60 - C6 -4LXC - LSTP_STASI -
22 PsiBlast_CBE 69.6848% -49 - C6 -4LXC - -
23 PsiBlast_CBE 69.3948% -53 - C6 -4LXC - LSTP_STASI -
20 PsiBlast_CBE 68.4848% -45 - C6 -4QPB - -
21 PsiBlast_CBE 68.2748% -45 - C6 -4QP5 - -
6 PsiBlast_PDB 67.7648% -49 - C6 -4LXC - LSTP_STASI -
5 PsiBlast_PDB 67.4948% -45 - C6 -4QPB - LSTP_STASI -
49 Fugue 62.6917% -11 - C6 -2GU1 - ? -
53 Fugue 60.9720% -10 - C6 -4RNZ - ? -
52 Fugue 59.2018% -3 - C6 -3SLU - ? -
10 PsiBlast_PDB 59.0229% -50 - C6 -4BH5 - ENVC_ECOLI -