@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0537: (2016-03-16 )
MALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALTAIVTMDKDTWSHDVTPLPMDVFEKQLETALSIGPDAIKTGMLGTEEIIKRAGEVYEASNAQYFVVDPVMVCKGEDEVLNPGNTEAMIKYLLPKATVVTPNLFEAGQLSGLGKLNSIEDMKKAATIIFDKGAQHVIIKGGKALDQDKSYDLYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTAYLANGKSPKEAVISAKAFVASAIKNGWKMNDFVGPVDHGAYNRIEHIDVEVTEV

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACP_B_8(4C5N)
?
[Raw transfer]




ACP_D_16(4C5N)
?
[Raw transfer]




ADP_H_8(2I5B)
PDXK_BACSU
[Raw transfer]




ACP_A_6(4C5N)
?
[Raw transfer]




ACP_B_10(4C5M)
?
[Raw transfer]




ACP_C_15(4C5M)
?
[Raw transfer]




ADP_B_9(4C5K)
?
[Raw transfer]




ADP_D_17(4C5K)
?
[Raw transfer]




ADP_A_5(4C5K)
?
[Raw transfer]




ACP_D_20(4C5M)
?
[Raw transfer]




ACP_A_5(4C5M)
?
[Raw transfer]




ADP_C_13(4C5K)
?
[Raw transfer]




ADP_G_7(2I5B)
PDXK_BACSU
[Raw transfer]




ADP_I_9(2I5B)
PDXK_BACSU
[Raw transfer]




HMH_H_8(1JXI)
THID_SALTY
[Raw transfer]




UEG_A_5(4C5L)
?
[Raw transfer]




UEG_C_10(4C5L)
?
[Raw transfer]




UEG_D_11(4C5L)
?
[Raw transfer]




HMH_G_7(1JXI)
THID_SALTY
[Raw transfer]




2 PsiBlast_PDB 98.67100% -96 - C2 -4C5K 8.0 ?
1 PsiBlast_PDB 98.42100% -94 * C2 *4C5J - ? -
22 PsiBlast_CBE 98.02100% -96 - C2 -4C5N 7.5 ?
25 PsiBlast_CBE 97.99100% -95 - C2 -4C5M 7.1 ?
21 PsiBlast_CBE 97.93100% -99 - C2 -4C5N 7.6 ?
33 PsiBlast_CBE 97.88100% -94 - C2 -4C5J - ? -
28 PsiBlast_CBE 97.76100% -94 - C2 -4C5K 7.0 ?
32 PsiBlast_CBE 97.63100% -93 - C2 -4C5J - ? -
4 PsiBlast_PDB 97.37100% -95 - C2 -4C5M 7.7 ?
31 PsiBlast_CBE 96.88100% -94 - C2 -4C5J - ? -
23 PsiBlast_CBE 96.84100% -94 - C2 -4C5M 7.4 ?
30 PsiBlast_CBE 96.79100% -94 - C2 -4C5K 6.8 ?
24 PsiBlast_CBE 96.71100% -94 - C2 -4C5M 7.4 ?
27 PsiBlast_CBE 96.60100% -92 - C2 -4C5L 2.6 ?
5 PsiBlast_PDB 96.52100% -95 - C2 -4C5N 7.8 ?
29 PsiBlast_CBE 96.37100% -94 - C2 -4C5K 7.1 ?
26 PsiBlast_CBE 96.37100% -96 - C2 -4C5L 3.4 ?
3 PsiBlast_PDB 95.21100% -96 - C2 -4C5L 2.2 ?
6 PsiBlast_PDB 77.9551% -82 - C2 -2I5B 7.4 PDXK_BACSU
36 PsiBlast_CBE 77.6151% -79 - C2 -2I5B 6.9 PDXK_BACSU
35 PsiBlast_CBE 77.5651% -81 - C2 -2I5B 6.2 PDXK_BACSU
39 PsiBlast_CBE 65.4531% -77 - C2 -1JXI 3.3 THID_SALTY
9 PsiBlast_PDB 64.6231% -76 - C2 -1JXI 3.3 THID_SALTY