@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0587: (2016-03-17 )
MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_B_6(3ZK7)
MTSA_STRPN
[Raw transfer]




21 PsiBlast_CBE 96.89100% -67 - C9 -4K3V - ? -
2 PsiBlast_PDB 96.04100% -67 - C9 -4NNO - ? -
3 PsiBlast_PDB 94.05100% -71 - C9 -4NNP - ? -
1 PsiBlast_PDB 88.71100% -70 - C9 -4K3V - ? -
5 PsiBlast_PDB 86.6268% -65 - C9 -4OXR - ? -
22 PsiBlast_CBE 86.5468% -66 - C9 -4OXR - ? -
4 PsiBlast_PDB 86.4568% -63 - C9 -4OXQ - ? -
31 PsiBlast_CBE 82.4751% -60 - C9 -3ZK9 - MTSA_STRPN -
28 PsiBlast_CBE 82.3952% -62 - C9 -3ZK7 3.0 MTSA_STRPN
24 PsiBlast_CBE 82.1250% -60 - C9 -4UTO - MTSA_STRPN -
7 PsiBlast_PDB 82.0751% -50 - C9 -1PSZ - MTSA_STRPN -
30 PsiBlast_CBE 82.0451% -61 - C9 -3ZKA - MTSA_STRPN -
6 PsiBlast_PDB 81.7550% -54 - C9 -4UTP - MTSA_STRPN -
25 PsiBlast_CBE 81.6751% -52 - C9 -3ZTT - MTSA_STRPN -
27 PsiBlast_CBE 81.6251% -53 - C9 -3ZTT - MTSA_STRPN -
26 PsiBlast_CBE 81.2851% -52 - C9 -3ZTT - MTSA_STRPN -
29 PsiBlast_CBE 81.1851% -62 - C9 -3ZK8 - MTSA_STRPN -
8 PsiBlast_PDB 81.0951% -53 - C9 -3ZTT - MTSA_STRPN -
63 Fugue 81.0650% -51 - C9 -1PSZ - MTSA_STRPN -
9 PsiBlast_PDB 80.9950% -54 - C9 -3HH8 - MTSA_STRP1 -