@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0759: (2016-03-18 )
MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MES_A_2(1ABA)
GLRX_BPT4
[Raw transfer]




FMT_A_7(3FZ4)
?
[Raw transfer]




32 HHSearch 91.30100%-105 - C2 -2M46 - ? -
1 PsiBlast_PDB 90.68100%-105 - C2 -2M46 - ? -
2 PsiBlast_PDB 69.6243%-106 - C2 -3FZ4 - ? -
38 HHSearch 66.7942% -90 - C2 -3FZ4 2.5 ?
50 Fugue 65.0420%-103 - C2 -1Z3E - SPX_BACSU -
4 PsiBlast_PDB 62.9923%-103 - C2 -3L78 - SPX_STRMU -
34 HHSearch 62.0221% -90 - C2 -1Z3E - SPX_BACSU -
31 HHSearch 59.8622% -89 - C2 -3F0I - ? -
30 HHSearch 59.4723% -88 - C2 -3L78 - SPX_STRMU -
6 PsiBlast_PDB 59.1623% -85 - C2 -1Z3E - SPX_BACSU -
9 PsiBlast_PDB 58.7421% -86 - C2 -3F0I - ? -
28 HHSearch 57.6118% -96 - C2 -1S3C - ARSC1_ECOLX -
27 HHSearch 57.5219% -82 - C2 -3RDW - ? -
7 PsiBlast_PDB 56.6422% -83 - C2 -3IHQ - SPX_BACSU -
5 PsiBlast_PDB 56.6123% -89 - C2 -3GFK - SPX_BACSU -
37 HHSearch 54.2640% -47 - C2 -3GKX - ? -
8 PsiBlast_PDB 53.9430% -98 - C2 -2KOK - ? -
3 PsiBlast_PDB 52.7141% -51 - C2 -3GKX - ? -
35 HHSearch 52.4825% -81 - C2 -2KOK - ? -
44 HHSearch 50.6724%-100 - C2 -3NZN - ? -
45 HHSearch 42.4531%-108 - C2 -1ABA 3.1 GLRX_BPT4