@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0805: (2016-03-19 )
MTHLLETFEMSIDHQEDGLVVISMPVTDKVKQPFGYLHGGASIALGETACSLGSANLIDTTKFIPLGLEMNANHIHSAKDGRVTATAEIIHRGKSTHVWDIKIKNDKEQLITVMRGTVAIKPLK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_D_6(4M20)
?
[Raw transfer]



COA_A_5(4M20)
?
[Raw transfer]
22 PsiBlast_CBE 98.59100%-110 - C1 -4M20 4.0 ?
23 PsiBlast_CBE 98.48100%-110 - C1 -4M20 3.9 ?
21 PsiBlast_CBE 97.41100%-106 - C1 -4M20 - ? -
1 PsiBlast_PDB 96.94100%-110 - C1 -4M20 - ? -
34 PsiBlast_CBE 75.0438%-106 - C1 -4K4B - MENI_ECOLI -
9 PsiBlast_PDB 74.7138%-108 - C1 -4K4B - MENI_ECOLI -
12 PsiBlast_PDB 74.6937%-107 - C1 -1SBK - MENI_ECOLI -
7 PsiBlast_PDB 74.2538%-103 - C1 -4K49 - MENI_ECOLI -
44 PsiBlast_CBE 73.7838%-102 - C1 -4K49 - MENI_ECOLI -
8 PsiBlast_PDB 73.4538%-105 - C1 -4K4A - MENI_ECOLI -
35 PsiBlast_CBE 73.3838%-105 - C1 -4K4B - MENI_ECOLI -
37 PsiBlast_CBE 73.3038%-106 - C1 -4K4B - MENI_ECOLI -
42 PsiBlast_CBE 73.0238%-107 - C1 -4K49 - MENI_ECOLI -
40 PsiBlast_CBE 73.0238%-106 - C1 -4K4A - MENI_ECOLI -
41 PsiBlast_CBE 72.9838%-110 - C1 -4K4A - MENI_ECOLI -
28 PsiBlast_CBE 72.9145% -89 - C1 -4QD8 - Y1618_PSEAE -
38 PsiBlast_CBE 72.7038%-103 - C1 -4K4B - MENI_ECOLI -
11 PsiBlast_PDB 72.5738%-100 - C1 -1VI8 - MENI_ECOLI -
33 PsiBlast_CBE 72.4138%-102 - C1 -4K4B - MENI_ECOLI -
39 PsiBlast_CBE 72.3838%-106 - C1 -4K4A - MENI_ECOLI -