@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0820: (2016-03-19 )
MTNSSKSFTKFMAASAVFTMGFLSVPTAGAEQTNQIANKPQAIQWHTNLTNERFTTIAHRGASGYAPEHTFQAYDKSHNELKASYIEIDLQRTKDGHLVAMHDETVNRTTNGHGKVEDYTLDELKQLDAGSWFNKKYPKYARASYKNAKVPTLDEILERYGPNANYYIETKSPDVYPGMEEQLLASLKKHHLLNNNKLKNGHVMIQSFSDESLKKIHRQNKHVPLVKLVDKGELQQFNDQRLKEIRSYAIGLGPDYTDLTEQNTHHLKDLGFIVHPYTVNEKADMLRLNKYGVDGVFTNFADKYKEVIK

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_5(3CH0)
?
[Raw transfer]




GOL_A_6(1YDY)
GLPQ_ECOLI
[Raw transfer]




GOL_A_4(2PZ0)
?
[Raw transfer]




GOL_B_6(2PZ0)
?
[Raw transfer]




GOL_A_19(3CH0)
?
[Raw transfer]




28 PsiBlast_CBE 97.91100% -67 - C2 -2OOG - ? -
30 PsiBlast_CBE 97.84100% -66 - C2 -2OOG - ? -
21 PsiBlast_CBE 97.72100% -65 - C2 -2P76 - ? -
32 PsiBlast_CBE 97.66100% -63 - C2 -2OOG - ? -
1 PsiBlast_PDB 97.53100% -66 - C2 -2OOG - ? -
45 HHSearch 97.35100% -65 - C2 -2OOG - ? -
29 PsiBlast_CBE 97.32100% -67 - C2 -2OOG - ? -
26 PsiBlast_CBE 97.28100% -64 - C2 -2P76 - ? -
31 PsiBlast_CBE 97.11100% -66 - C2 -2OOG - ? -
25 PsiBlast_CBE 96.98100% -65 - C2 -2P76 - ? -
23 PsiBlast_CBE 96.53100% -64 - C2 -2P76 - ? -
22 PsiBlast_CBE 96.50100% -64 - C2 -2P76 - ? -
2 PsiBlast_PDB 96.50100% -64 - C2 -2P76 - ? -
24 PsiBlast_CBE 96.29100% -65 - C2 -2P76 - ? -
27 PsiBlast_CBE 96.25100% -65 - C2 -2P76 - ? -
38 PsiBlast_CBE 86.0748% -71 - C2 -4R7O - ? -
36 PsiBlast_CBE 85.9048% -71 - C2 -4R7O - ? -
3 PsiBlast_PDB 85.6248% -71 - C2 -4R7O - ? -
33 PsiBlast_CBE 85.3848% -75 - C2 -4R7O - ? -
37 PsiBlast_CBE 85.0948% -73 - C2 -4R7O - ? -
50 HHSearch 71.0138% -61 - C2 -2PZ0 2.6 ?
55 HHSearch 68.4233% -50 - C2 -1YDY 2.5 GLPQ_ECOLI
39 PsiBlast_CBE 66.5738% -59 - C2 -2PZ0 2.6 ?