@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0942: (2016-03-20 )
MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV

Atome Classification :

(41 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BB2_A_3(2OS3)
DEF_STRP1
[Raw transfer]




BB2_A_6(2OS1)
DEF_ENTFA
[Raw transfer]




SB8_A_4(2AIA)
DEF_STRR6
[Raw transfer]




BB2_B_7(2OKL)
DEF2_BACCR
[Raw transfer]




BB2_A_4(1LQY)
DEF2_GEOSE
[Raw transfer]




BB2_B_11(3M6R)
DEF1B_ARATH
[Raw transfer]




BB2_D_22(3M6R)
DEF1B_ARATH
[Raw transfer]




BB2_A_5(2OKL)
DEF2_BACCR
[Raw transfer]




EPE_B_6(1VEY)
DEF_LEPIN
[Raw transfer]




SB7_A_4(2AI7)
DEF_STRR6
[Raw transfer]




BB2_B_9(3M6P)
DEF1B_ARATH
[Raw transfer]




BB2_A_2(3PN4)
DEF1B_ARATH
[Raw transfer]




BB2_A_5(3UWB)
?
[Raw transfer]




SB9_P_4(2AIE)
DEF_STRR6
[Raw transfer]




EPE_A_5(1VEY)
DEF_LEPIN
[Raw transfer]




BB2_A_5(3M6R)
DEF1B_ARATH
[Raw transfer]




BB2_A_3(3M6P)
DEF1B_ARATH
[Raw transfer]




BB2_C_16(3M6R)
DEF1B_ARATH
[Raw transfer]




5LI_P_4(3SW8)
?
[Raw transfer]




BB2_A_2(3M6Q)
DEF1B_ARATH
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




FMT_A_8(1VEV)
DEF_LEPIN
[Raw transfer]




MES_B_6(1VEV)
DEF_LEPIN
[Raw transfer]




FMT_A_12(1VEZ)
DEF_LEPIN
[Raw transfer]




FMT_B_18(1VEZ)
DEF_LEPIN
[Raw transfer]




MES_A_5(1VEV)
DEF_LEPIN
[Raw transfer]




BB4_A_8(3O3J)
DEF1B_ARATH
[Raw transfer]




GLY_B_5(1Y6H)
DEF_LEPIN
[Raw transfer]




DTT_B_6(1SV2)
DEF_LEPIN
[Raw transfer]




DTT_A_5(1SV2)
DEF_LEPIN
[Raw transfer]




CHAIN_F_3(3G6N)
?
[Raw transfer]

-

CHAIN_G_4(3G6N)
?
[Raw transfer]

-

1 PsiBlast_PDB 99.00100%-108 - C7 -1LQW - DEF_STAAU -
21 PsiBlast_CBE 98.12100%-104 - C7 -2AI9 - DEF_STAAU -
22 PsiBlast_CBE 98.00100% -98 - C7 -1LQW - DEF_STAAU -
2 PsiBlast_PDB 97.71100%-106 - C7 -2AI9 - DEF_STAAU -
3 PsiBlast_PDB 95.5496%-101 - C7 -1LMH - DEF_STAAU -
7 PsiBlast_PDB 84.8854% -92 - C7 -2OS3 5.9 DEF_STRP1
5 PsiBlast_PDB 84.4857% -86 - C7 -1LQY 6.7 DEF2_GEOSE
106 HHSearch 82.9259% -87 - C7 -2OKL - DEF2_BACCR -
23 PsiBlast_CBE 82.4459% -94 - C7 -2OKL 6.5 DEF2_BACCR
4 PsiBlast_PDB 82.3559% -89 - C7 -2OKL 6.2 DEF2_BACCR
6 PsiBlast_PDB 81.9554%-101 - C7 -2OS1 6.0 DEF_ENTFA
10 PsiBlast_PDB 81.6653%-102 - C7 -2OS0 - DEF_ENTFA -
101 HHSearch 81.5651% -94 - C7 -2OS0 - DEF_ENTFA -
25 PsiBlast_CBE 81.0054%-102 - C7 -3CMD - ? -
8 PsiBlast_PDB 80.8254%-104 - C7 -3G6N 2.8 ?
12 PsiBlast_PDB 80.6951% -98 - C7 -2AIE 4.4 DEF_STRR6
9 PsiBlast_PDB 80.6154%-103 - C7 -3CMD - ? -
24 PsiBlast_CBE 80.3854%-103 - C7 -3G6N 2.6 ?
11 PsiBlast_PDB 80.0751% -95 - C7 -3SW8 5.2 ?
14 PsiBlast_PDB 80.0651% -96 - C7 -2AIA 5.1 DEF_STRR6
13 PsiBlast_PDB 80.0151% -94 - C7 -2AI7 4.3 DEF_STRR6
17 PsiBlast_PDB 63.6035% -71 - C7 -3UWB 6.7 ?
39 PsiBlast_CBE 63.3434% -48 - C7 -1SV2 2.4 DEF_LEPIN
20 PsiBlast_PDB 63.2534% -46 - C7 -1VEV 3.0 DEF_LEPIN
33 PsiBlast_CBE 63.1634% -44 - C7 -1Y6H 3.2 DEF_LEPIN
36 PsiBlast_CBE 63.0934% -43 - C7 -1VEY 3.0 DEF_LEPIN
18 PsiBlast_PDB 62.9634% -45 - C7 -1Y6H 3.4 DEF_LEPIN
38 PsiBlast_CBE 62.7634% -45 - C7 -1VEV 2.3 DEF_LEPIN
37 PsiBlast_CBE 62.6434% -40 - C7 -1VEY 2.8 DEF_LEPIN
19 PsiBlast_PDB 62.5834% -50 - C7 -1SV2 2.0 DEF_LEPIN
35 PsiBlast_CBE 62.3434% -46 - C7 -1VEZ 3.2 DEF_LEPIN
34 PsiBlast_CBE 62.3334% -46 - C7 -1VEZ 3.2 DEF_LEPIN
56 PsiBlast_CBE 56.0439%-100 - C7 -3M6R 5.3 DEF1B_ARATH
47 PsiBlast_CBE 56.0439%-105 - C7 -3O3J 4.2 DEF1B_ARATH
53 PsiBlast_CBE 56.0139%-112 - C7 -3M6Q 4.6 DEF1B_ARATH
59 PsiBlast_CBE 55.9239%-100 - C7 -3M6R 5.4 DEF1B_ARATH
58 PsiBlast_CBE 55.6139%-103 - C7 -3M6R 4.8 DEF1B_ARATH
43 PsiBlast_CBE 55.2839%-100 - C7 -3PN4 6.3 DEF1B_ARATH
48 PsiBlast_CBE 54.9639%-106 - C7 -3M6P 5.7 DEF1B_ARATH
57 PsiBlast_CBE 54.5539%-100 - C7 -3M6R 5.5 DEF1B_ARATH
49 PsiBlast_CBE 53.7339%-106 - C7 -3M6P 5.9 DEF1B_ARATH