@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1259: (2016-03-23 )
MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK

Atome Classification :

(70 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

N22_X_2(3I8A)
DYR_STAAU
[Raw transfer]




N22_A_3(3FQO)
?
[Raw transfer]




11F_A_3(3FQV)
?
[Raw transfer]




TOP_F_21(2W9S)
DYRA_STAAU
[Raw transfer]




53T_X_3(3F0X)
?
[Raw transfer]




55V_A_2(3FQF)
?
[Raw transfer]




GOL_A_3(4Q6A)
?
[Raw transfer]




I2H_X_3(3FRA)
DYR_STAAU
[Raw transfer]




TOP_E_19(2W9S)
DYRA_STAAU
[Raw transfer]




TOP_D_16(2W9S)
DYRA_STAAU
[Raw transfer]




52V_A_5(3LG4)
DYR_STAAU
[Raw transfer]




52V_X_3(3F0V)
?
[Raw transfer]




53R_X_3(3F0U)
?
[Raw transfer]




GOL_F_20(2W9S)
DYRA_STAAU
[Raw transfer]




I2H_X_3(3FY8)
DYR_STAAU
[Raw transfer]




5WB_A_4(3JWK)
?
[Raw transfer]




5WB_B_6(3JWK)
?
[Raw transfer]




GOL_H_8(1ZDR)
?
[Raw transfer]




MTX_A_2(2QK8)
?
[Raw transfer]




NAP_A_3(3FQZ)
?
[Raw transfer]




NAP_A_4(3NRR)
?
[Raw transfer]




NAP_X_2(3FRA)
DYR_STAAU
[Raw transfer]




NAP_A_2(3FQO)
?
[Raw transfer]




NAP_A_3(3JW5)
?
[Raw transfer]




NAP_X_2(3F0V)
?
[Raw transfer]




NAP_A_2(4Q6A)
?
[Raw transfer]




NAP_X_2(3FRD)
DYR_STAAU
[Raw transfer]




NDP_X_4(4XEC)
?
[Raw transfer]




NAP_A_3(3FQF)
?
[Raw transfer]




NAP_A_3(4FGG)
DYR_STAAU
[Raw transfer]




NAP_X_2(3F0S)
?
[Raw transfer]




NAP_X_2(3F0X)
?
[Raw transfer]




NAP_A_2(3FQV)
?
[Raw transfer]




NAP_A_3(3DAT)
?
[Raw transfer]




NDP_A_2(3TQ8)
?
[Raw transfer]




NDP_C_14(2W9S)
DYRA_STAAU
[Raw transfer]




NAP_X_2(4LAG)
DYR_STAAU
[Raw transfer]




NAP_X_2(3F0B)
?
[Raw transfer]




NAP_X_3(3SRW)
DYR_STAAU
[Raw transfer]




NDP_A_2(2BL9)
DRTS_PLAVI
[Raw transfer]




NAP_X_2(4LEK)
DYR_STAAU
[Raw transfer]




NAP_X_2(3F0Q)
?
[Raw transfer]




NDP_B_11(2W9S)
DYRA_STAAU
[Raw transfer]




NAP_A_3(3JWK)
?
[Raw transfer]




NAP_A_2(3FQ0)
?
[Raw transfer]




NAP_X_2(3FYV)
DYR_STAAU
[Raw transfer]




NAP_X_2(3SRQ)
DYR_STAAU
[Raw transfer]




NAP_A_3(3JVX)
?
[Raw transfer]




NAP_X_3(4LAH)
DYR_STAAU
[Raw transfer]




NAP_X_2(3SR5)
DYR_STAAU
[Raw transfer]




NDP_A_8(2W9S)
DYRA_STAAU
[Raw transfer]




NAP_B_4(3LG4)
DYR_STAAU
[Raw transfer]




NAP_A_3(3SH2)
DYR_STAAU
[Raw transfer]




NAP_A_3(3S9U)
?
[Raw transfer]




NAP_X_2(4LAE)
DYR_STAAU
[Raw transfer]




NAP_B_5(3JWK)
?
[Raw transfer]




NAP_B_5(3JVX)
?
[Raw transfer]




NAP_A_3(3LG4)
DYR_STAAU
[Raw transfer]




NAP_A_3(3FQC)
?
[Raw transfer]




NAP_X_3(3SRS)
DYR_STAAU
[Raw transfer]




NAP_A_2(4Q67)
?
[Raw transfer]




NAP_X_2(3SRU)
DYR_STAAU
[Raw transfer]




NAP_X_2(3SQY)
DYR_STAAU
[Raw transfer]




NAP_B_5(3JWC)
?
[Raw transfer]




NAP_X_3(3I8A)
DYR_STAAU
[Raw transfer]




NAP_X_3(3SRR)
DYR_STAAU
[Raw transfer]




NDP_X_2(4TU5)
?
[Raw transfer]




NAP_A_3(3JWC)
?
[Raw transfer]




NAP_A_3(3JWF)
?
[Raw transfer]




NAP_B_5(3JW5)
?
[Raw transfer]




NAP_B_5(3JWM)
?
[Raw transfer]




NAP_B_5(3SGY)
DYR_STAAU
[Raw transfer]




NAP_X_2(3FY8)
DYR_STAAU
[Raw transfer]




NAP_X_2(3FYW)
DYR_STAAU
[Raw transfer]




NAP_A_3(3JWM)
?
[Raw transfer]




NAP_X_2(3FY9)
DYR_STAAU
[Raw transfer]




NAP_B_4(3SH2)
DYR_STAAU
[Raw transfer]




NAP_B_5(3FQC)
?
[Raw transfer]




NAP_B_5(3JWF)
?
[Raw transfer]




NAP_X_2(3FRE)
DYR_STAAU
[Raw transfer]




NAP_X_2(3FRB)
DYR_STAAU
[Raw transfer]




NAP_X_2(3F0U)
?
[Raw transfer]




NAP_X_2(3FRF)
DYR_STAAU
[Raw transfer]




NAP_A_3(3SGY)
DYR_STAAU
[Raw transfer]




41 PsiBlast_CBE 98.57100%-152 - C6 -3SH2 12.9 DYR_STAAU
14 PsiBlast_PDB 98.40100%-147 - C6 -3FYV 12.1 DYR_STAAU
12 PsiBlast_PDB 98.18100%-152 - C6 -4LAH 13.3 DYR_STAAU
16 PsiBlast_PDB 98.01100%-152 - C6 -3FRD 12.7 DYR_STAAU
42 PsiBlast_CBE 97.94100%-151 - C6 -3SH2 13.0 DYR_STAAU
20 PsiBlast_PDB 97.93100%-151 - C6 -3SR5 13.6 DYR_STAAU
15 PsiBlast_PDB 97.89100%-146 - C6 -3FYW 12.2 DYR_STAAU
7 PsiBlast_PDB 97.80100%-154 - C6 -3SRS 13.2 DYR_STAAU
18 PsiBlast_PDB 97.73100%-152 - C6 -3FRF 11.6 DYR_STAAU
11 PsiBlast_PDB 97.55100%-150 - C6 -4LAG 13.2 DYR_STAAU
9 PsiBlast_PDB 97.51100%-153 - C6 -3SRW 13.2 DYR_STAAU
10 PsiBlast_PDB 97.48100%-150 - C6 -4LAE 13.2 DYR_STAAU
17 PsiBlast_PDB 97.45100%-149 - C6 -3FRE 12.3 DYR_STAAU
21 PsiBlast_CBE 97.3599%-149 - C6 -3FY9 12.2 DYR_STAAU
13 PsiBlast_PDB 97.30100%-151 - C6 -4LEK 13.4 DYR_STAAU
1 PsiBlast_PDB 97.30100%-146 - C6 -4FGG 12.1 DYR_STAAU
8 PsiBlast_PDB 97.25100%-153 - C6 -3SRU 13.3 DYR_STAAU
4 PsiBlast_PDB 97.12100%-151 - C6 -3SQY 13.4 DYR_STAAU
5 PsiBlast_PDB 97.09100%-150 - C6 -3SRQ 13.5 DYR_STAAU
30 PsiBlast_CBE 97.05100%-153 - C6 -3FQC 12.6 ?
22 PsiBlast_CBE 97.0199%-149 - C6 -3FY8 12.1 DYR_STAAU
6 PsiBlast_PDB 97.00100%-153 - C6 -3SRR 13.2 DYR_STAAU
19 PsiBlast_PDB 96.8999%-151 - C6 -4Q67 13.1 ?
23 PsiBlast_CBE 96.8899%-154 - C6 -3FRB 12.7 DYR_STAAU
29 PsiBlast_CBE 96.86100%-150 - C6 -3FQC 12.5 ?
31 PsiBlast_CBE 96.85100%-150 - C6 -3FQ0 12.9 ?
36 PsiBlast_CBE 96.8499%-151 - C6 -3FQO 12.4 ?
27 PsiBlast_CBE 96.69100%-148 - C6 -4TU5 13.0 ?
25 PsiBlast_CBE 96.6498%-152 - C6 -4Q6A 13.4 ?
32 PsiBlast_CBE 96.48100%-146 - C6 -3F0S 11.5 ?
24 PsiBlast_CBE 96.2599%-148 - C6 -3FRA 12.7 DYR_STAAU
43 PsiBlast_CBE 96.12100%-145 - C6 -3SGY 12.5 DYR_STAAU
38 PsiBlast_CBE 96.1299%-148 - C6 -3F0X 10.9 ?
33 PsiBlast_CBE 96.05100%-148 - C6 -3F0Q 13.2 ?
44 PsiBlast_CBE 95.91100%-145 - C6 -3SGY 12.4 DYR_STAAU
39 PsiBlast_CBE 95.9099%-149 - C6 -3F0V 12.9 ?
37 PsiBlast_CBE 95.7899%-144 - C6 -3FQF 12.0 ?
40 PsiBlast_CBE 95.7399%-148 - C6 -3F0U 13.3 ?
28 PsiBlast_CBE 95.62100%-149 - C6 -3FQZ 11.4 ?
35 PsiBlast_CBE 95.4999%-145 - C6 -3FQV 11.7 ?
26 PsiBlast_CBE 95.47100%-143 - C6 -4XEC 11.3 ?
34 PsiBlast_CBE 95.20100%-149 - C6 -3F0B 12.6 ?
46 PsiBlast_CBE 95.1798%-152 - C6 -3LG4 11.5 DYR_STAAU
47 PsiBlast_CBE 95.0198%-148 - C6 -3I8A 13.1 DYR_STAAU
45 PsiBlast_CBE 94.6298%-152 - C6 -3LG4 12.2 DYR_STAAU
48 PsiBlast_CBE 91.4581%-141 - C6 -2W9S 4.7 DYRA_STAAU
49 PsiBlast_CBE 91.2981%-142 - C6 -2W9S 4.9 DYRA_STAAU
53 PsiBlast_CBE 91.1281%-140 - C6 -2W9S 12.7 DYRA_STAAU
50 PsiBlast_CBE 90.7681%-140 - C6 -2W9S 4.9 DYRA_STAAU
51 PsiBlast_CBE 90.7181%-139 - C6 -2W9S 12.5 DYRA_STAAU
52 PsiBlast_CBE 90.5281%-141 - C6 -2W9S 12.7 DYRA_STAAU
60 PsiBlast_CBE 79.7744%-134 - C6 -3JWC 12.0 ?
57 PsiBlast_CBE 79.4044%-128 - C6 -3JWK 12.3 ?
69 PsiBlast_CBE 79.3543%-129 - C6 -3JVX 12.4 ?
113 HHSearch 79.2343%-133 * C6 *3S9U 12.4 ?
62 PsiBlast_CBE 79.1644%-127 - C6 -3JW5 11.6 ?
56 PsiBlast_CBE 79.1144%-128 - C6 -3JWK 12.2 ?
59 PsiBlast_CBE 78.9944%-133 - C6 -3JWF 12.1 ?
112 HHSearch 78.9143%-140 - C6 -3TQ8 12.1 ?
61 PsiBlast_CBE 78.7844%-130 - C6 -3JWC 12.1 ?
68 PsiBlast_CBE 78.5843%-130 - C6 -3JVX 12.2 ?
66 PsiBlast_CBE 78.4443%-129 - C6 -3JWM 11.7 ?
58 PsiBlast_CBE 78.2944%-130 - C6 -3JWF 11.9 ?
64 PsiBlast_CBE 77.6743%-128 - C6 -3DAT 10.0 ?
63 PsiBlast_CBE 77.6344%-126 - C6 -3JW5 12.1 ?
67 PsiBlast_CBE 77.3543%-127 - C6 -3JWM 11.9 ?
65 PsiBlast_CBE 76.5143%-130 - C6 -2QK8 8.4 ?
54 PsiBlast_CBE 75.5249%-129 - C6 -1ZDR 2.0 ?
129 HHSearch 69.0132%-129 - C6 -3NRR 11.0 ?
117 HHSearch 62.5333%-100 - C6 -2BL9 11.6 DRTS_PLAVI