@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1305: (2016-03-24 )
MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_H_4(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(2IIE)

[Raw transfer]

-

NACID_E_3(1IHF)
IHFB_ECOLI
[Raw transfer]

-

NACID_I_3(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P78)
DBH_NOSS1
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_D_2(2HT0)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(1OWF)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1OWF)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1OWG)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(2IIF)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(2IIE)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(2IIE)
IHFA_ECOLI
[Raw transfer]

-

NACID_E_3(2HT0)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_F_2(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_E_3(1OWG)
IHFB_ECOLI
[Raw transfer]

-

NACID_I_3(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1OUZ)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(1P78)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1OUZ)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1OWF)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(1OWF)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

1 PsiBlast_PDB 92.99100% -60 - C9 -4QJN - DBH_STAAM -
2 PsiBlast_PDB 90.16100% -49 - C9 -4QJU 6.3 DBH_STAAM
21 PsiBlast_CBE 88.60100% -42 - C9 -4QJU 7.2 DBH_STAAM
3 PsiBlast_PDB 82.8080% -48 - C9 -1HUE - DBH_GEOSE -
5 PsiBlast_PDB 79.7771% -46 - C9 -3RHI - ? -
4 PsiBlast_PDB 78.5980% -58 - C9 -1HUU - DBH_GEOSE -
53 Fugue 76.4477% -58 * C9 *1HUU - DBH_GEOSE -
36 HHSearch 73.5859% -62 - C9 -1MUL - DBHA_ECOLI -
7 PsiBlast_PDB 73.4158% -62 - C9 -1MUL - DBHA_ECOLI -
35 HHSearch 73.3139% -48 - C9 -1OWF 3.4 IHFB_ECOLI
34 HHSearch 72.6259% -67 - C9 -1B8Z - DBH_THEMA -
11 PsiBlast_PDB 72.4758% -67 - C9 -1B8Z - DBH_THEMA -
10 PsiBlast_PDB 71.3551% -34 - C9 -1P78 4.8 DBH_NOSS1
26 PsiBlast_CBE 71.1751% -37 - C9 -1P51 5.6 DBH_NOSS1
27 PsiBlast_CBE 70.8851% -35 - C9 -1P51 3.9 DBH_NOSS1
25 PsiBlast_CBE 70.7951% -34 - C9 -1P51 4.3 DBH_NOSS1
17 PsiBlast_PDB 70.7639% -49 - C9 -1OWF 3.4 IHFB_ECOLI
8 PsiBlast_PDB 70.6551% -33 - C9 -1P51 4.2 DBH_NOSS1
16 PsiBlast_PDB 70.5439% -47 - C9 -1OUZ 2.0 IHFB_ECOLI
24 PsiBlast_CBE 70.4551% -35 - C9 -1P71 1128214396763122245304320.0 DBH_NOSS1
28 PsiBlast_CBE 69.9838% -39 - C9 -2HT0 2.8 IHFA_ECOLI
33 HHSearch 69.8951% -34 - C9 -1P71 1128214396763122245304320.0 DBH_NOSS1
15 PsiBlast_PDB 69.6439% -46 - C9 -2HT0 5.4 IHFB_ECOLI
14 PsiBlast_PDB 69.5739% -47 - C9 -1OWG 1128214396763122245304320.0 IHFB_ECOLI
9 PsiBlast_PDB 69.4851% -35 - C9 -1P71 1128214396763122245304320.0 DBH_NOSS1
18 PsiBlast_PDB 69.3438% -32 - C9 -2IIF 2.8 IHFA_ECOLI (first)
13 PsiBlast_PDB 69.3139% -44 - C9 -1IHF Error IHFB_ECOLI
39 HHSearch 69.2339% -41 - C9 -1OWF 3.0 IHFA_ECOLI
23 PsiBlast_CBE 69.1651% -38 - C9 -1P78 4.5 DBH_NOSS1
29 PsiBlast_CBE 69.1538% -39 - C9 -1OWG 2.8 IHFA_ECOLI
30 PsiBlast_CBE 69.0238% -41 - C9 -1OWF 3.0 IHFA_ECOLI
31 PsiBlast_CBE 68.6938% -43 - C9 -1OUZ 2.7 IHFA_ECOLI
40 HHSearch 68.6739% -37 - C9 -2IIE 2.8 IHFA_ECOLI (first)
19 PsiBlast_PDB 68.4738% -37 - C9 -2IIE 2.8 IHFA_ECOLI (first)
41 HHSearch 29.5739% 31 - C9 -2IIE 3.8