@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1331: (2016-03-24 )
MQKNILKSGIALSELGLGCMSLGTDLKKAEQIIDCAVENGITYFDTADMYDKGINESVVGKALLKYQQRDDIFIGTKVGNRLTKDGSTTWDPSKSYIKEAVKGSLKRLGIDHIDLYQLHGGTIDDPLDETISAFDELKQEGIIRAYGISSIRPNVIDYYLKHSQIETIMSQFNLIDNRPESLLDAIHNNDVKVLARGPVSKGLLTSNSVNVLDNKFKDGIFDYSHDELGETIASIKEIESNLSALTFSYLTSHDVLGSIIVGASSVDQLKENIENYHTKVGLDQIKTARARVKDLEYTNHLV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_17(1YNP)
?
[Raw transfer]




GOL_A_17(1YNP)
?
[Raw transfer]




NDP_B_16(1YNQ)
?
[Raw transfer]




1 PsiBlast_PDB 93.7252%-111 - C4 -1YNP 2.6 ?
2 PsiBlast_PDB 91.4752%-107 - C4 -1YNQ - ? -
22 PsiBlast_CBE 88.6952% -91 - C4 -1YNP - ? -
33 HHSearch 87.8850% -93 - C4 -1YNP 2.6 ?
21 PsiBlast_CBE 87.5652% -93 - C4 -1YNQ 11.0 ?
9 PsiBlast_PDB 72.1727% -89 - C4 -1LQA - TAS_ECOLI -
17 PsiBlast_PDB 70.4225% -75 - C4 -2R9R - KCAB2_RAT -
19 PsiBlast_PDB 69.9825% -77 - C4 -4JTA - KCAB2_RAT -
13 PsiBlast_PDB 69.9427% -91 - C4 -4AST - GPR_ECOLI -
4 PsiBlast_PDB 69.7824% -89 - C4 -1PYF - IOLS_BACSU -
11 PsiBlast_PDB 69.6127% -90 - C4 -4AUB - GPR_ECOLI -
15 PsiBlast_PDB 69.4726% -77 - C4 -1ZSX - KCAB2_HUMAN -
10 PsiBlast_PDB 69.2526% -76 - C4 -3EB4 - KCAB2_RAT -
5 PsiBlast_PDB 69.1824% -86 - C4 -1PZ0 - IOLS_BACSU -
20 PsiBlast_PDB 68.6725% -75 - C4 -4JTC - KCAB2_RAT -
16 PsiBlast_PDB 68.1025% -75 - C4 -2A79 - KCAB2_RAT -
18 PsiBlast_PDB 68.0225% -78 - C4 -3LNM - KCAB2_RAT -
12 PsiBlast_PDB 67.5527% -88 - C4 -3N6Q - GPR_ECOLI -
31 HHSearch 67.0027% -79 - C4 -1LQA - TAS_ECOLI -
36 HHSearch 64.9927% -80 - C4 -3N6Q - GPR_ECOLI -