@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1675: (2016-03-28 )
MGLSADYAPMEFEHTVNGKTEYAGVDIDLAKKIAKDNNLKLKIVNMSFDSLLGALKTGKIDIIISGMTSTPERKKQVDFSDSYMMTKNIMLVKKDKVNEYKDIKDFNNKKVGAQKGTEQEKIAQTEIENASITSLSRLPDVILALKSGKVEGAVVEKPVAEAYLKQNPKLGISNVKFNEEEKDTVIAVPKDSPKLLSQINKTIKEVKDKGLIDKYMTNAANAMNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIEILRGTPMLVQVFIVFFGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKGQMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQVVQGISFDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARG_B_4(4PSH)
?
[Raw transfer]




ARG_B_4(4YMX)
?
[Raw transfer]




ARG_B_17(4H5G)
?
[Raw transfer]




MES_B_15(4KPT)
?
[Raw transfer]




62 Fugue 76.1315% -96 - C1 -4Q0C - BVGS_BORPE -
24 PsiBlast_CBE 74.7736% -52 - C1 -4H5G 5.3 ?
7 PsiBlast_PDB 74.5036% -55 - C1 -4H5F - ? -
26 PsiBlast_CBE 74.3636% -47 - C1 -4H5F - ? -
9 PsiBlast_PDB 74.1440% -57 - C1 -4YMX - ? -
11 PsiBlast_PDB 74.0738% -51 - C1 -4PSH - ? -
28 PsiBlast_CBE 74.0340% -55 - C1 -4YMX 4.8 ?
27 PsiBlast_CBE 73.5436% -51 - C1 -4H5F - ? -
8 PsiBlast_PDB 73.2836% -51 - C1 -4H5G - ? -
29 PsiBlast_CBE 72.9538% -51 - C1 -4PSH 5.1 ?
54 Fugue 72.3448%-134 - C2 -4YMU - ? -
14 PsiBlast_PDB 70.9231% -58 - C1 -2Y7I - ? -
32 PsiBlast_CBE 70.9031% -57 - C1 -2Y7I - ? -
23 PsiBlast_CBE 70.6149%-137 - C2 -4YMT - ? -
22 PsiBlast_CBE 70.4449%-138 - C2 -4YMU - ? -
5 PsiBlast_PDB 70.3749%-139 - C2 -4YMW - ? -
2 PsiBlast_PDB 70.3749%-139 - C2 -4YMT - ? -
4 PsiBlast_PDB 69.7549%-135 - C2 -4YMV - ? -
10 PsiBlast_PDB 69.6538% -57 - C1 -4PRS - ? -
61 Fugue 69.6216% -74 - C1 -4P0G - MLTF_PSEAE -
30 PsiBlast_CBE 66.2132% -43 - C1 -4KPT 3.1 ?