@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1716: (2016-03-28 )
MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDELQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHKENAVLIGKLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPLSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTSAPVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLPNTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIFLGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLTMYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHDVYEKL

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ASN_A_5(2DQN)
GATA_STAAM
[Raw transfer]



GLN_A_5(2F2A)
GATA_STAAM
[Raw transfer]



GLN_A_4(4N0I)
GATA_YEAST
[Raw transfer]



MPD_A_6(2GI3)
GATA_THEMA
[Raw transfer]
5 PsiBlast_PDB 92.10100% -61 - C5 -3IP4 - GATA_STAAM -
99 HHSearch 91.7399% -61 - C5 -3IP4 - GATA_STAAM -
6 PsiBlast_PDB 91.31100% -62 - C5 -2F2A 4.2 GATA_STAAM
1 PsiBlast_PDB 90.98100% -62 - C5 -2DF4 - GATA_STAAM -
2 PsiBlast_PDB 90.93100% -63 - C5 -2DQN 3.8 GATA_STAAM
3 PsiBlast_PDB 90.85100% -62 - C5 -2G5H - GATA_STAAM -
4 PsiBlast_PDB 89.79100% -59 - C5 -2G5I - GATA_STAAM -
9 PsiBlast_PDB 78.3153% -51 - C5 -3H0R - GATA_AQUAE -
7 PsiBlast_PDB 78.2953% -52 - C5 -3H0L - GATA_AQUAE -
34 PsiBlast_CBE 77.9953% -53 - C5 -3H0M - GATA_AQUAE -
100 HHSearch 77.9453% -52 - C5 -3H0L - GATA_AQUAE -
8 PsiBlast_PDB 77.7753% -52 - C5 -3H0M - GATA_AQUAE -
27 PsiBlast_CBE 77.3253% -52 - C5 -3H0R - GATA_AQUAE -
10 PsiBlast_PDB 76.2750% -51 - C5 -4WJ3 - GATA_PSEAE -
101 HHSearch 74.2443% -49 - C5 -3KFU - GATA_THET8 -
13 PsiBlast_PDB 71.6943% -48 - C5 -3KFU - GATA_THET8 -
12 PsiBlast_PDB 70.0348% -48 - C5 -2GI3 - GATA_THEMA -
11 PsiBlast_PDB 69.0947% -50 - C5 -3AL0 - GATA_THEMA -
103 HHSearch 68.1448% -48 - C5 -2GI3 2.5 GATA_THEMA
16 PsiBlast_PDB 64.0333% -36 * C5 *3A1K - ? -
15 PsiBlast_PDB 60.9037% -46 - C5 -4N0I 3.4 GATA_YEAST