@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1720: (2016-03-28 )
MADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFKKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFPAEEVVTKLLDIELSIGRTGVVTPTAILEPVKVAGTTVSRASLHNEDLIHDRDIRIGDSVVVKKAGDIIPEVVRSIPERRPEDAVTYHMPTHCPSCGHELVRIEGEVALRCINPKCQAQLVEGLIHFVSRQAMNIDGLGTKIIQQLYQSELIKDVADIFYLTEEDLLPLDRMGQKKVDNLLAAIQQAKDNSLENLLFGLGIRHLGVKASQVLAEKYETIDRLLTVTEAELVEIHDIGDKVAQSVVTYLENEDIRALIQKLKDKHVNMIYKGIKTSDIEGHPEFSGKTIVLTGKLHQMTRNEASKWLASQGAKVTSSVTKNTDVVIAGEDAGSKLTKAQSLGIEIWTEQQFVDKQNELNS

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3BA_A_7(3BAA)
DNLJ_ENTFA
[Raw transfer]




3BD_A_7(3BAB)
DNLJ_ENTFA
[Raw transfer]




0OW_A_5(4EFB)
DNLJ_ENTFA
[Raw transfer]




3B9_A_7(3BA9)
DNLJ_ENTFA
[Raw transfer]




0OV_A_5(4EFE)
DNLJ_ENTFA
[Raw transfer]




0OX_A_5(4EEQ)
DNLJ_ENTFA
[Raw transfer]




3B8_A_6(3BA8)
DNLJ_ENTFA
[Raw transfer]




0XT_B_6(4GLW)
DNLJ_STRZP
[Raw transfer]




AMP_D_10(2OWO)
DNLJ_ECOLI
[Raw transfer]




IVH_A_2(3PN1)
DNLJ_HAEIN
[Raw transfer]




0XT_A_4(4GLW)
DNLJ_STRZP
[Raw transfer]




3B9_A_5(3BAC)
DNLJ_HAEIN
[Raw transfer]




0XS_A_7(4GLX)
DNLJ_ECOLI
[Raw transfer]




L5Y_A_3(4CC6)
DNLJ_STAAU
[Raw transfer]




GOL_E_5(1TA8)
DNLJ_ENTFA
[Raw transfer]




AMP_B_2(1ZAU)
DNLJ_MYCTU
[Raw transfer]




AMP_B_2(1ZAU)
DNLJ_MYCTU
[Raw transfer]




AMP_A_5(1DGS)
DNLJ_THEFI
[Raw transfer]




AMP_A_3(3UQ8)
DNLJ_HAEIN
[Raw transfer]




AMP_A_3(3UQ8)
DNLJ_HAEIN
[Raw transfer]




1X8_A_2(4LH7)
DNLJ_ENTFA
[Raw transfer]




AMP_A_5(1V9P)
DNLJ_THEFI
[Raw transfer]




1X7_A_2(4LH6)
DNLJ_ENTFA
[Raw transfer]




AMP_B_6(1V9P)
DNLJ_THEFI
[Raw transfer]




AMP_A_2(3SGI)
DNLJ_MYCTU
[Raw transfer]




AMP_B_6(1DGS)
DNLJ_THEFI
[Raw transfer]




AMP_A_2(3SGI)
DNLJ_MYCTU
[Raw transfer]




NACID_D_3(4GLX)
DNLJ_ECOLI
[Raw transfer]

-

NACID_D_3(2OWO)
DNLJ_ECOLI
[Raw transfer]

-

NACID_D_3(2OWO)
DNLJ_ECOLI
[Raw transfer]

-

NACID_C_2(2OWO)
DNLJ_ECOLI
[Raw transfer]

-

NACID_C_2(4GLX)
DNLJ_ECOLI
[Raw transfer]

-

36 HHSearch 87.6745% -79 - C6 -2OWO 6.4 DNLJ_ECOLI
58 Fugue 87.3644% -70 - C6 -1DGS - DNLJ_THEFI -
4 PsiBlast_PDB 87.0644% -80 - C6 -2OWO 6.8 DNLJ_ECOLI
23 PsiBlast_CBE 86.8745% -70 - C6 -1V9P 5.1 DNLJ_THEFI
7 PsiBlast_PDB 86.6845% -74 - C6 -1V9P 5.0 DNLJ_THEFI
22 PsiBlast_CBE 86.6444% -70 - C6 -1DGS 5.4 DNLJ_THEFI
6 PsiBlast_PDB 86.0344% -85 - C6 -4GLX 8.2 DNLJ_ECOLI
5 PsiBlast_PDB 85.3244% -67 - C6 -1DGS 5.2 DNLJ_THEFI
40 HHSearch 79.34100% -60 - C6 -3JSL - DNLJ_STAAU -
21 PsiBlast_CBE 79.2599% -60 - C6 -3JSL - DNLJ_STAAU -
1 PsiBlast_PDB 79.1499% -60 - C6 -3JSL - DNLJ_STAAU -
2 PsiBlast_PDB 78.9999% -59 - C6 -4CC5 - DNLJ_STAAU -
3 PsiBlast_PDB 78.0099% -59 - C6 -4CC6 7.1 DNLJ_STAAU
20 PsiBlast_PDB 70.0657% -56 - C6 -4EFE 7.0 DNLJ_ENTFA
18 PsiBlast_PDB 69.8857% -54 - C6 -4EEQ 5.1 DNLJ_ENTFA
19 PsiBlast_PDB 69.4857% -57 - C6 -4EFB 6.5 DNLJ_ENTFA
11 PsiBlast_PDB 69.2657% -54 - C6 -3BA8 6.4 DNLJ_ENTFA
13 PsiBlast_PDB 69.2257% -54 - C6 -3BAA 8.1 DNLJ_ENTFA
12 PsiBlast_PDB 69.2257% -57 - C6 -3BA9 8.3 DNLJ_ENTFA
17 PsiBlast_PDB 69.1057% -54 - C6 -1TA8 2.3 DNLJ_ENTFA
15 PsiBlast_PDB 68.5757% -53 - C6 -4LH6 4.6 DNLJ_ENTFA
14 PsiBlast_PDB 68.0457% -53 - C6 -3BAB 8.1 DNLJ_ENTFA
16 PsiBlast_PDB 67.8757% -53 - C6 -4LH7 4.6 DNLJ_ENTFA
29 PsiBlast_CBE 65.5447% -41 - C6 -3UQ8 6.4 DNLJ_HAEIN
38 HHSearch 65.5348% -39 - C6 -3UQ8 6.4 DNLJ_HAEIN
30 PsiBlast_CBE 64.7247% -39 - C6 -3PN1 7.0 DNLJ_HAEIN
37 HHSearch 63.3639% -39 - C6 -3SGI 4.4 DNLJ_MYCTU
27 PsiBlast_CBE 62.6251% -50 - C6 -4GLW 4.5 DNLJ_STRZP
9 PsiBlast_PDB 61.8438% -39 - C6 -3SGI 4.4 DNLJ_MYCTU
28 PsiBlast_CBE 60.9651% -46 - C6 -4GLW 5.0 DNLJ_STRZP
41 HHSearch 60.4540% -43 - C6 -1ZAU 5.2 DNLJ_MYCTU
31 PsiBlast_CBE 57.9640% -37 - C6 -1ZAU 5.2 DNLJ_MYCTU
32 PsiBlast_CBE 56.0945% -39 - C6 -3BAC 8.6 DNLJ_HAEIN