@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1731: (2016-03-28 )
MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNLFEVIKAVADDDTSIGVVPIENSIEGTINIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQFDYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFDQNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAITTDIKKVIAILETLDFKVEMIGAFN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PHE_B_4(3MWB)
?
[Raw transfer]




PHE_B_4(3MWB)
?
[Raw transfer]




PPY_A_2(3LUY)
?
[Raw transfer]




13 HHSearch 98.90100%-143 - C5 -2QMW - ? -
1 PsiBlast_PDB 97.9098%-143 - C5 -2QMW - ? -
14 HHSearch 70.5327%-114 - C5 -2QMX - ? -
15 HHSearch 69.4925%-117 - C5 -3LUY - ? -
12 HHSearch 69.1031%-113 - C5 -3MWB 3.8 ?
2 PsiBlast_PDB 66.7229%-109 - C5 -3MWB 3.0 ?
4 PsiBlast_PDB 64.4827%-123 - C5 -3LUY 3.1 ?
5 PsiBlast_PDB 59.9126% -88 - C5 -2QMX - ? -
3 PsiBlast_PDB 55.3433%-128 - C5 -4LUB - ? -
38 Fugue 51.3625%-150 - C5 -1PHZ - PH4H_RAT -
17 HHSearch 49.5131%-132 - C5 -1PHZ - PH4H_RAT -
7 PsiBlast_PDB 44.8631%-130 - C5 -2PHM - PH4H_RAT -
39 Fugue 44.3125% -97 - C5 -1PHZ - PH4H_RAT -
6 PsiBlast_PDB 44.1331%-122 - C5 -1PHZ - PH4H_RAT -
40 Fugue 39.9510% -87 - C2 -1HYN - B3AT_HUMAN -
24 HHSearch 38.1817% -70 - C5 -1Y7P - Y1403_ARCFU -
21 HHSearch 35.1515% -58 - C5 -2PC6 - ? -
22 HHSearch 34.6316% -70 * C5 *2F1F - ILVH_ECOLI -
41 Fugue 34.6118% -56 - C1 -4CI0 - ? -
23 HHSearch 34.1725% -71 - C5 -2FGC - ? -