@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1745: (2016-03-28 )
MKLEHITKKYGSNVVLNDIDFDFGDSRIVGLIGKNGVGKTTIMKVMNGNIIKFDGKVDIDNADNIGFLIEHPKLYDNKSGLYNLKLFAQVLGKGFDKAYTDKIIDAFGMRPYIKKKVKKYSMGMKQKLAIAVSLMNKPKFLILDEPTNGMDPDGSIDVLTTIKSLVNELDMRILISSHKLEDIELICDRAVFLRDGHFVQDVNMEVGVASDTTIVTVDHKDFDRTEKYLAEHFQLQNVDKADGHLMINAQKNYQVILKALSELDIYPKYIETRKSSLRDTYFNINQRGDK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




14 PsiBlast_PDB 87.1525% -93 - C1 -2OLJ - ? -
16 PsiBlast_PDB 87.0425% -95 - C1 -2OUK - ? -
17 PsiBlast_PDB 86.2725% -93 - C1 -2Q0H - ? -
15 PsiBlast_PDB 85.8625% -93 - C1 -2OLK - ? -
1 PsiBlast_PDB 85.7631%-108 - C1 -1VPL - ? -
18 PsiBlast_PDB 84.7525% -91 - C1 -3C4J - ? -
19 PsiBlast_PDB 84.6925% -95 - C1 -3C41 - ? -
3 PsiBlast_PDB 83.2724%-105 - C1 -4WBS - ? -
28 HHSearch 76.3925% -95 - C1 -3TUI - METN_ECOLI -
20 PsiBlast_PDB 75.8924% -80 - C1 -4P32 - LPTB_ECOLI -
38 HHSearch 74.6925% -95 * C1 *2OLJ - ? -
12 PsiBlast_PDB 70.8025% -98 - C1 -3TUI - METN_ECOLI -
9 PsiBlast_PDB 70.0028% -97 - C1 -4YMW - ? -
6 PsiBlast_PDB 69.1828% -96 - C1 -4YMT - ? -
7 PsiBlast_PDB 68.3928% -92 - C1 -4YMU - ? -
40 HHSearch 68.2624% -90 - C1 -2PCJ - LOLD_AQUAE -
32 HHSearch 67.7926%-103 - C1 -3GFO - ECFA3_CLOP1 -
13 PsiBlast_PDB 67.4425%-104 - C1 -3TUZ - METN_ECOLI -
8 PsiBlast_PDB 67.3128% -93 - C1 -4YMV - ? -
5 PsiBlast_PDB 66.6528% -93 - C1 -4YMS - ? -