@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1873: (2016-03-29 )
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_C_3(4MDX)
ENDOA_BACSU
[Raw transfer]

-

2 PsiBlast_PDB 96.85100%-133 - C2 -4MZP - MAZF_STAAN -
1 PsiBlast_PDB 93.92100%-117 - C2 -4OF1 - MAZF_STAAM -
4 PsiBlast_PDB 93.27100%-131 - C2 -4MZM - MAZF_STAAN -
3 PsiBlast_PDB 93.14100%-129 - C2 -4MZT - MAZF_STAAN -
7 PsiBlast_PDB 88.3269%-122 - C2 -4HKE - ? -
17 PsiBlast_CBE 88.1167%-116 - C2 -4MDX 12.0 ENDOA_BACSU
6 PsiBlast_PDB 86.6467%-116 - C2 -1NE8 - ENDOA_BACSU -
5 PsiBlast_PDB 86.3967%-116 - C2 -4MDX - ENDOA_BACSU -
18 PsiBlast_CBE 84.9969%-121 - C2 -4HKE - ? -
8 PsiBlast_PDB 77.7566%-126 - C2 -4ME7 - ENDOA_BACSU -
20 HHSearch 57.1628% -87 - C2 -1M1F - PEMK_ECOLX -
29 Fugue 56.7028% -83 - C2 -1M1F - PEMK_ECOLX -
19 HHSearch 56.0122% -90 * C2 *1UB4 - MAZF_ECOLI -
9 PsiBlast_PDB 53.9029% -71 - C2 -1M1F - PEMK_ECOLX -
10 PsiBlast_PDB 52.5129% -64 - C2 -2C06 - PEMK_ECOLX -
22 HHSearch 49.0014% -97 - C2 -3VUB - CCDB_ECOLI -
11 PsiBlast_PDB 46.7625%-149 - C2 -3NFC - MAZF_ECOLI -
12 PsiBlast_PDB 44.9425%-104 - C2 -1UB4 - MAZF_ECOLI -
21 HHSearch 40.9621% -51 - C2 -2KMT - ? -
15 PsiBlast_PDB 38.2525% -12 - C2 -4ANI - DNAK_GEOKA -