@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA2100: (2016-04-01 )
MKKNFKLRISTLLLIVILVVFAVLLIVNETKLFKNDVNYSFDEAVSMQQGKGIVQTKEEDGKFVEANNNEIAKAMTISHKDNDMKYMDITEKVPMSESEVNQLLKGKGILENRGKVFLEAQEKYEVNVIYLVSHALVETGNGKSELAKGIKDGKKRYYNFFGIGAFDSSAVRSGKSYAEKEQWTSPDKAIIGGAKFIRNEYFENNQLNLYQMRWNPENPAQHQYASDIRWADKIAKLMDKSYKQFGIKKDDIRQTYYK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_3(4Q2W)

[Raw transfer]
1 PsiBlast_PDB 96.5930% -60 - C6 -4Q2W 3.6
22 HHSearch 77.2025% -23 - C6 -3FI7 - ? -
45 Fugue 67.8018% -1 - C3 -4Q4D - VIP2_HUMAN -
39 Fugue 65.4119% 33 - C5 -3ZXU - CTF19_KLULA -
44 Fugue 63.4614% -8 - C5 -4LCT - CSN1_ARATH -
42 Fugue 62.2416% -8 - C2 -1TL2 - TAL2_TACTR -
7 PsiBlast_PDB 56.2726% 21 - C6 -2G5I - GATB_STAAM -
8 PsiBlast_PDB 55.7426% 9 - C6 -3IP4 - GATB_STAAM -
5 PsiBlast_PDB 54.2026% 19 - C6 -2F2A - GATB_STAAM -
4 PsiBlast_PDB 53.9326% 19 - C6 -2DQN - GATB_STAAM -
43 Fugue 53.9218% 3 - C4 -4ZCF - ? -
6 PsiBlast_PDB 53.7326% 17 - C6 -2G5H - GATB_STAAM -
41 Fugue 52.4412% -36 - C5 -2F96 - RNT_PSEAE -
3 PsiBlast_PDB 50.5926% 23 - C6 -2DF4 - GATB_STAAM -
23 HHSearch 44.7823% -31 - C6 -1QUS - MLTB_ECOLI -
14 PsiBlast_PDB 44.4127% 5 - C6 -2D5R - TOB1_HUMAN -
9 PsiBlast_PDB 44.2427% 17 - C6 -2Z15 - TOB1_HUMAN -
25 HHSearch 43.3715% 5 - C6 -1GBS - LYG_CYGAT -
16 PsiBlast_PDB 40.0030% -7 - C6 -3FI7 - ? -
17 PsiBlast_PDB 38.7840% 42 - C6 -3VTE - THCAS_CANSA -