@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA2187: (2016-04-01 )
METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGTIHAIHNICPHKQGPLSEGTVSGEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FES_A_2(3D89)
RFESD_MOUSE
[Raw transfer]




60 HHSearch 93.5828%-132 - C2 -2JO6 - NIRD_ECOLI -
61 HHSearch 91.4229%-133 * C2 *2QPZ - NDOA_PSEPU -
69 HHSearch 89.5928%-132 - C2 -3D89 3.6 RFESD_MOUSE
80 Fugue 89.2028%-137 - C2 -2JO6 - NIRD_ECOLI -
64 HHSearch 87.9830%-111 - C2 -2JZA - ? -
12 PsiBlast_PDB 85.4628%-119 - C2 -4NB9 - CARAC_PSERE -
4 PsiBlast_PDB 85.3128%-128 - C2 -1VCK - CARAC_PSERE -
82 Fugue 85.0027%-136 - C2 -3D89 - RFESD_MOUSE -
10 PsiBlast_PDB 84.7228%-123 - C2 -3VMI - CARAC_PSERE -
8 PsiBlast_PDB 84.0628%-116 - C2 -3VMG - CARAC_PSERE -
6 PsiBlast_PDB 83.9028%-113 - C2 -2DE6 - CARAC_PSERE -
81 Fugue 83.8626%-121 - C2 -4P1B - TMOC_PSEME -
7 PsiBlast_PDB 83.7228%-119 - C2 -2DE7 - CARAC_PSERE -
20 PsiBlast_PDB 83.6228%-120 - C2 -4NBH - CARAC_PSERE -
14 PsiBlast_PDB 83.5328%-115 - C2 -4NBB - CARAC_PSERE -
9 PsiBlast_PDB 83.0628%-116 - C2 -3VMH - CARAC_PSERE -
19 PsiBlast_PDB 83.0528%-115 - C2 -4NBG - CARAC_PSERE -
17 PsiBlast_PDB 82.9428%-119 - C2 -4NBE - CARAC_PSERE -
15 PsiBlast_PDB 82.7028%-118 - C2 -4NBC - CARAC_PSERE -
13 PsiBlast_PDB 82.5928%-118 - C2 -4NBA - CARAC_PSERE -