@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA2502: (2016-04-04 )
MEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PPV_A_4(4JG4)
RNPA_BACSU
[Raw transfer]
11 HHSearch 93.1099%-109 - C2 -1D6T - RNPA_STAAU -
1 PsiBlast_PDB 93.1099%-109 - C2 -1D6T - RNPA_STAAU -
20 Fugue 93.0699%-108 - C2 -1D6T - RNPA_STAAU -
3 PsiBlast_PDB 81.4450%-112 - C2 -4JG4 3.1 RNPA_BACSU
2 PsiBlast_PDB 81.1751%-116 - C2 -1A6F - RNPA_BACSU -
12 HHSearch 69.7436%-113 - C2 -1NZ0 - RNPA_THEMA -
5 PsiBlast_PDB 67.7145%-132 - C2 -3Q1R - RNPA_THEMA -
4 PsiBlast_PDB 67.6845%-132 - C2 -3Q1Q - RNPA_THEMA -
9 PsiBlast_CBE 67.2245%-134 - C2 -1NZ0 - RNPA_THEMA -
10 PsiBlast_CBE 67.0045%-126 - C2 -1NZ0 - RNPA_THEMA -
8 PsiBlast_CBE 66.2945%-128 - C2 -1NZ0 - RNPA_THEMA -
6 PsiBlast_PDB 64.5645%-121 - C2 -1NZ0 - RNPA_THEMA -
13 HHSearch 61.8123% -90 - C2 -2LJP - RNPA_ECOLI -
7 PsiBlast_PDB 61.0324% -98 - C2 -2LJP - RNPA_ECOLI -
25 Fugue 36.2415% -57 - C1 -1EKJ - CAHC_PEA -
22 Fugue 34.7222% -33 - C2 -2FTX - -
17 HHSearch 24.2817% -39 - C2 -3R3T - RS6_BACAN -
23 Fugue 23.5813% -12 - C2 -2JQN - ? -
18 HHSearch 22.8816% 6 - C2 -3N8B - ? -
15 HHSearch 19.3426% 72 - C2 -1LYP - -