@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0002: (2015-12-11 )
MQIIEGKLQLQGNEKIAILTSRFNHIITDRLKEGAMDCFKRHGGDEELLDLVLVPGAYELPLILDKLLESGKYDGVCVLGAIIRGGTPHFDYVSAEATKGIASAMLKYSMPVSFGVLTTDNIEQAIERAGSKAGNKGFEAMSTLIELLSLCQTLKD

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

RDL_D_14(1NQU)
RISB_AQUAE
[Raw transfer]




RDL_E_15(1NQU)
RISB_AQUAE
[Raw transfer]




RDL_A_11(1NQU)
RISB_AQUAE
[Raw transfer]




RDL_B_12(1NQU)
RISB_AQUAE
[Raw transfer]




RDL_C_13(1NQU)
RISB_AQUAE
[Raw transfer]




RLP_E_15(1NQX)
RISB_AQUAE
[Raw transfer]




RLP_D_14(1NQX)
RISB_AQUAE
[Raw transfer]




RLP_C_13(1NQX)
RISB_AQUAE
[Raw transfer]




RLP_B_12(1NQX)
RISB_AQUAE
[Raw transfer]




TP6_A_19(2C92)
RISB_MYCTU
[Raw transfer]




RLP_A_11(1NQX)
RISB_AQUAE
[Raw transfer]




87 PsiBlast_CBE 90.5849%-119 - C6 -1ZIS - RISB_BACSU -
94 PsiBlast_CBE 90.4449%-120 - C6 -1ZIS - RISB_BACSU -
92 PsiBlast_CBE 90.2949%-119 - C6 -1ZIS - RISB_BACSU -
89 PsiBlast_CBE 90.1549%-120 - C6 -1ZIS - RISB_BACSU -
96 PsiBlast_CBE 90.0649%-120 - C6 -1RVV - RISB_BACSU -
8 PsiBlast_PDB 89.6649%-120 - C6 -1RVV - RISB_BACSU -
23 PsiBlast_CBE 89.6350%-117 - C6 -1NQX 4.9 RISB_AQUAE
197 Fugue 89.5049%-121 - C6 -1RVV - ? -
9 PsiBlast_PDB 89.5049%-118 - C6 -1ZIS - RISB_BACSU -
86 PsiBlast_CBE 89.4948%-118 - C6 -3MK3 - RISB_SALTY -
61 PsiBlast_CBE 89.2248%-117 - C6 -3NQ4 - RISB_SALTY -
22 PsiBlast_CBE 89.1850%-117 - C6 -1NQX 4.8 RISB_AQUAE
209 HHSearch 89.0949%-116 - C6 -3NQ4 - RISB_SALTY -
208 HHSearch 88.9349%-119 - C6 -1RVV - RISB_BACSU -
93 PsiBlast_CBE 88.9349%-119 - C6 -1ZIS - RISB_BACSU -
95 PsiBlast_CBE 88.8949%-119 - C6 -1ZIS - RISB_BACSU -
4 PsiBlast_PDB 88.8550%-119 - C6 -1NQW - RISB_AQUAE -
91 PsiBlast_CBE 88.7549%-118 - C6 -1ZIS - RISB_BACSU -
24 PsiBlast_CBE 88.7350%-116 - C6 -1NQX 4.9 RISB_AQUAE
7 PsiBlast_PDB 88.6948%-116 - C6 -3NQ4 - RISB_SALTY -
34 PsiBlast_CBE 88.5850%-117 - C6 -1NQU 5.4 RISB_AQUAE
21 PsiBlast_CBE 88.5050%-116 - C6 -1NQX 4.9 RISB_AQUAE
36 PsiBlast_CBE 88.1150%-116 - C6 -1NQU 5.4 RISB_AQUAE
35 PsiBlast_CBE 88.0550%-115 - C6 -1NQU 5.3 RISB_AQUAE
5 PsiBlast_PDB 87.6850%-117 - C6 -1NQX 5.0 RISB_AQUAE
2 PsiBlast_PDB 87.3350%-116 - C6 -1NQU 5.5 RISB_AQUAE
33 PsiBlast_CBE 87.3250%-115 - C6 -1NQU 5.4 RISB_AQUAE
216 HHSearch 75.9936%-117 * C6 *2C92 6.3 RISB_MYCTU