@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0028: (2015-12-11 )
MKMHQIPTPTMSQVIMLNDSITTAEFMVSALRDFFDKPLEEAQKLMLSIHRDGDGVCGVYPYEIAIYKAVCVRDKARARFPLRLMVQEVK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_D_4(3GW1)
CLPS_CAUCR
[Raw transfer]

-

CHAIN_C_3(3GW1)
CLPS_CAUCR
[Raw transfer]

-

CHAIN_D_4(3G1B)
CLPS_CAUCR
[Raw transfer]

-

CHAIN_D_3(3G3P)
CLPS_CAUCR
[Raw transfer]

-

2 PsiBlast_PDB 96.3843%-137 - C2 -3GQ0 - CLPS_CAUCR -
20 PsiBlast_CBE 96.1744%-136 - C2 -3G3P Error CLPS_CAUCR
21 PsiBlast_CBE 95.7344%-143 - C2 -3G1B Error CLPS_CAUCR
24 PsiBlast_CBE 95.4443%-141 - C2 -3DNJ - CLPS_CAUCR -
22 PsiBlast_CBE 95.1943%-141 - C2 -3GW1 3.7 CLPS_CAUCR
1 PsiBlast_PDB 95.1943%-135 - C2 -3G19 - CLPS_CAUCR -
23 PsiBlast_CBE 94.5943%-142 - C2 -3GQ1 - CLPS_CAUCR -
3 PsiBlast_PDB 94.5443%-139 - C2 -3GW1 3.8 CLPS_CAUCR
39 HHSearch 92.1534%-128 - C2 -2W9R - CLPS_ECOLI -
37 HHSearch 88.2836%-137 - C2 -3O1F - CLPS_ECOLI -
51 Fugue 86.6034%-116 * C2 *1MG9 - CLPS_ECOLI -
26 PsiBlast_CBE 86.1140%-134 - C2 -1R6Q - CLPS_ECOLI -
27 PsiBlast_CBE 85.7240%-135 - C2 -1R6O - CLPS_ECOLI -
9 PsiBlast_PDB 83.7440%-135 - C2 -1R6O - CLPS_ECOLI -
28 PsiBlast_CBE 83.0240%-138 - C2 -1MBX - CLPS_ECOLI -
10 PsiBlast_PDB 82.7540%-134 - C2 -1R6Q - CLPS_ECOLI -
29 PsiBlast_CBE 82.1440%-136 - C2 -1MBU - CLPS_ECOLI -
11 PsiBlast_PDB 81.7340%-133 - C2 -2W9R - CLPS_ECOLI -
8 PsiBlast_PDB 81.3340%-133 - C2 -1MBX - CLPS_ECOLI -
36 PsiBlast_CBE 81.2940%-133 - C2 -3O2B - CLPS_ECOLI -