@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0082: (2015-12-12 )
MQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL

Atome Classification :

(67 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMC_A_3(3NM5)
MQMTN_HELPJ
[Raw transfer]




MTA_B_4(4BMZ)
MQMTN_HELPY
[Raw transfer]




MTA_A_2(4P54)
MQMTN_HELPJ
[Raw transfer]




FMC_B_4(3NM5)
MQMTN_HELPJ
[Raw transfer]




MTA_A_3(4BMZ)
MQMTN_HELPY
[Raw transfer]




SAH_A_2(4OY3)
MQMTN_HELPJ
[Raw transfer]




MTA_C_3(1Z5O)
MTNN_ECOLI
[Raw transfer]




FMC_C_3(1NC3)
MTNN_ECOLI
[Raw transfer]




MTA_B_3(4G41)
?
[Raw transfer]




MTA_D_4(1Z5O)
MTNN_ECOLI
[Raw transfer]




MTM_B_4(3EEI)
?
[Raw transfer]




MTH_C_3(1NC1)
MTNN_ECOLI
[Raw transfer]




MTH_D_4(1NC1)
MTNN_ECOLI
[Raw transfer]




BIG_A_2(4FFS)
MQMTN_HELPJ
[Raw transfer]




FMC_A_2(3BL6)
MTNN_STAAM
[Raw transfer]




MTM_D_4(1Y6R)
MTNN_ECOLI
[Raw transfer]




MTM_A_3(3EEI)
?
[Raw transfer]




MTM_C_3(1Y6R)
MTNN_ECOLI
[Raw transfer]




MTM_A_3(3EEI)
?
[Raw transfer]




FMC_A_2(3BL6)
MTNN_STAAM
[Raw transfer]




FMC_D_4(1NC3)
MTNN_ECOLI
[Raw transfer]




2EL_B_7(4F2P)
?
[Raw transfer]




TDI_A_5(1Y6Q)
MTNN_ECOLI
[Raw transfer]




TDI_A_3(4F2W)
?
[Raw transfer]




TDI_A_3(4WKB)
?
[Raw transfer]




TDI_B_6(1Y6Q)
MTNN_ECOLI
[Raw transfer]




TDI_B_8(4F2W)
?
[Raw transfer]




TDI_B_5(4X24)
?
[Raw transfer]




TDI_B_4(4WKB)
?
[Raw transfer]




TDI_A_3(4X24)
?
[Raw transfer]




4CT_B_6(3O4V)
MTNN_ECOLI
[Raw transfer]




DF9_A_3(3DF9)
MTNN_ECO57
[Raw transfer]




2WP_A_2(4OJT)
MQMTN_HELPJ
[Raw transfer]




2EL_A_3(4F2P)
?
[Raw transfer]




4CT_A_3(3O4V)
MTNN_ECOLI
[Raw transfer]




BIG_B_5(4F3C)
?
[Raw transfer]




BIG_A_2(4WKC)
?
[Raw transfer]




DF9_B_4(3DF9)
MTNN_ECO57
[Raw transfer]




ADE_B_2(3NM6)
MQMTN_HELPJ
[Raw transfer]




BIG_A_3(4F3C)
?
[Raw transfer]




BIG_C_5(3DP9)
MTNN_VIBCH
[Raw transfer]




HCE_B_5(4F3K)
?
[Raw transfer]




HCE_A_3(4F3K)
?
[Raw transfer]




BIG_A_3(3DP9)
MTNN_VIBCH
[Raw transfer]




ADE_B_4(4BMX)
MQMTN_HELPY
[Raw transfer]




4F0_A_2(4YML)
?
[Raw transfer]




SR1_C_3(1Z5N)
MTNN_ECOLI
[Raw transfer]




SR1_E_5(1Z5N)
MTNN_ECOLI
[Raw transfer]




GOL_A_4(1Z5P)
MTNN_ECOLI
[Raw transfer]




ADE_A_6(4JWT)
?
[Raw transfer]




ADE_A_3(4JOS)
?
[Raw transfer]




TRS_A_3(3NM4)
MQMTN_HELPJ
[Raw transfer]




Q88_A_2(3MMS)
?
[Raw transfer]




SAH_A_4(4G89)
MTNN_KLEP7
[Raw transfer]




EDO_B_6(3NM4)
MQMTN_HELPJ
[Raw transfer]




ADE_A_6(4QEZ)
MTNN_BACAN
[Raw transfer]




ADE_B_4(4QEZ)
MTNN_BACAN
[Raw transfer]




ADE_D_4(1JYS)
MTNN_ECOLI
[Raw transfer]




ADE_C_3(1JYS)
MTNN_ECOLI
[Raw transfer]




ADE_C_9(4QEZ)
MTNN_BACAN
[Raw transfer]




PGE_B_15(4F1W)
?
[Raw transfer]




PG4_A_5(4F1W)
?
[Raw transfer]




EDO_A_6(4F2W)
?
[Raw transfer]




PE5_A_3(1Z5P)
MTNN_ECOLI
[Raw transfer]




22 PsiBlast_CBE 97.26100%-126 - C1 -3NM4 3.5 MQMTN_HELPJ
8 PsiBlast_PDB 96.4195%-126 - C1 -4BMX - MQMTN_HELPY -
2 PsiBlast_PDB 96.27100%-117 - C1 -3NM5 6.0 MQMTN_HELPJ
21 PsiBlast_CBE 96.17100%-117 - C1 -3NM5 6.0 MQMTN_HELPJ
1 PsiBlast_PDB 96.09100%-117 - C1 -3NM4 2.5 MQMTN_HELPJ
6 PsiBlast_PDB 95.6899%-120 - C1 -4P54 6.9 MQMTN_HELPJ
3 PsiBlast_PDB 95.66100%-116 - C1 -3NM6 4.0 MQMTN_HELPJ
4 PsiBlast_PDB 95.54100%-117 - C1 -4FFS 6.9 MQMTN_HELPJ
7 PsiBlast_PDB 95.0499%-119 - C1 -4OY3 7.3 MQMTN_HELPJ
9 PsiBlast_PDB 94.8095%-125 - C1 -4BN0 - MQMTN_HELPY -
5 PsiBlast_PDB 94.56100%-115 - C1 -4OJT 3.6 MQMTN_HELPJ
24 PsiBlast_CBE 94.0395%-117 - C1 -4BMZ 6.5 MQMTN_HELPY
10 PsiBlast_PDB 93.6195%-117 - C1 -4BMZ 6.6 MQMTN_HELPY
23 PsiBlast_CBE 93.2895%-115 - C1 -4BMX 4.2 MQMTN_HELPY
11 PsiBlast_PDB 93.1895%-121 - C1 -4BMY - MQMTN_HELPY -
13 PsiBlast_PDB 77.3549%-107 - C1 -4JOS 4.2 ?
12 PsiBlast_PDB 74.3449%-109 - C1 -4JWT 3.9 ?
73 PsiBlast_CBE 68.5531%-104 - C1 -4G41 - ? -
14 PsiBlast_PDB 68.3735%-101 - C1 -4GMH - MTNN_STAAM -
72 PsiBlast_CBE 68.2931%-100 - C1 -4G41 6.5 ?
61 PsiBlast_CBE 67.8734% -96 - C1 -4YML 6.2 ?
76 HHSearch 67.7136% -97 - C1 -3EEI 6.0 ?
47 PsiBlast_CBE 67.6334%-101 - C1 -4F1W 2.1 ?
25 PsiBlast_CBE 67.5236%-102 - C1 -3EEI 6.0 ?
17 PsiBlast_PDB 67.3336% -98 - C1 -3EEI 6.0 ?
75 HHSearch 67.3034% -93 * C1 *3BL6 6.1 MTNN_STAAM
39 PsiBlast_CBE 67.1534% -94 - C1 -4F3K 5.9 ?
54 PsiBlast_CBE 67.1434% -96 - C1 -1Y6Q 6.3 MTNN_ECOLI
70 PsiBlast_CBE 67.0034% -96 - C1 -1Z5O 6.9 MTNN_ECOLI
62 PsiBlast_CBE 66.9734% -96 - C1 -4WKC 6.7 ?
44 PsiBlast_CBE 66.9534% -94 - C1 -4F2P 6.4 ?
15 PsiBlast_PDB 66.8035% -95 - C1 -3BL6 6.1 MTNN_STAAM
45 PsiBlast_CBE 66.7734% -94 - C1 -4F2P 6.1 ?
51 PsiBlast_CBE 66.6734% -97 - C1 -1Y6R 6.2 MTNN_ECOLI
66 PsiBlast_CBE 66.5934% -98 - C1 -1Z5N 3.5 MTNN_ECOLI
50 PsiBlast_CBE 66.4034%-102 - C1 -1Z5P 2.6 MTNN_ECOLI
42 PsiBlast_CBE 66.3634% -91 - C1 -4F2W 6.3 ?
71 PsiBlast_CBE 66.2834% -95 - C1 -1Z5O 6.6 MTNN_ECOLI
58 PsiBlast_CBE 66.2634% -94 - C1 -1NC1 6.2 MTNN_ECOLI
52 PsiBlast_CBE 65.9234% -94 - C1 -1Y6R 6.1 MTNN_ECOLI
37 PsiBlast_CBE 65.8532% -94 - C1 -4G89 3.1 MTNN_KLEP7
48 PsiBlast_CBE 65.8434% -94 - C1 -3DF9 6.6 MTNN_ECO57
64 PsiBlast_CBE 65.8034% -95 - C1 -3O4V 7.3 MTNN_ECOLI
38 PsiBlast_CBE 65.7434% -94 - C1 -4F3K 5.8 ?
53 PsiBlast_CBE 65.7034% -95 - C1 -1Y6Q 6.2 MTNN_ECOLI
65 PsiBlast_CBE 65.6534% -97 - C1 -1Z5N 3.3 MTNN_ECOLI
49 PsiBlast_CBE 65.6434% -96 - C1 -3DF9 6.7 MTNN_ECO57
63 PsiBlast_CBE 65.6134% -93 - C1 -3O4V 7.1 MTNN_ECOLI
27 PsiBlast_CBE 65.6132% -92 - C1 -4WKB 6.1 ?
59 PsiBlast_CBE 65.5934%-102 - C1 -1JYS 3.9 MTNN_ECOLI
28 PsiBlast_CBE 65.5231% -94 - C1 -4X24 6.0 ?
56 PsiBlast_CBE 65.1234% -97 - C1 -1NC3 5.4 MTNN_ECOLI
57 PsiBlast_CBE 65.1034% -92 - C1 -1NC1 6.6 MTNN_ECOLI
19 PsiBlast_PDB 65.0432% -95 - C1 -4WKB 6.2 ?
43 PsiBlast_CBE 65.0034% -92 - C1 -4F2W 6.5 ?
46 PsiBlast_CBE 64.9834% -93 - C1 -4F1W 2.0 ?
40 PsiBlast_CBE 64.9534% -93 - C1 -4F3C 6.6 ?
41 PsiBlast_CBE 64.8334% -96 - C1 -4F3C 6.8 ?
60 PsiBlast_CBE 64.4334% -99 - C1 -1JYS 3.7 MTNN_ECOLI
26 PsiBlast_CBE 64.4332% -95 - C1 -3DP9 5.6 MTNN_VIBCH
55 PsiBlast_CBE 64.3534% -94 - C1 -1NC3 5.7 MTNN_ECOLI
20 PsiBlast_PDB 64.2931% -91 - C1 -4X24 6.1 ?
18 PsiBlast_PDB 63.6732% -97 - C1 -3DP9 6.4 MTNN_VIBCH
67 PsiBlast_CBE 61.4834% -91 - C1 -4QEZ 3.7 MTNN_BACAN
69 PsiBlast_CBE 61.4634% -91 - C1 -4QEZ 4.7 MTNN_BACAN
68 PsiBlast_CBE 61.2934% -90 - C1 -4QEZ 3.5 MTNN_BACAN
35 PsiBlast_CBE 60.1331% -93 - C1 -3MMS 3.9 ?