@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0099: (2015-12-12 )
MILTAMQDAIGRTPIFKFTRKDYPIPLKSAIYAKLEHLNPGGSVKDRLGQYLIKEAFRTRKITSTTTIIEPTAGNTGIALALVAIKHHLKTIFVVPKKFSTEKQQIMRALGALVINTPTSEGISGAIKKSKELAESIPDSYLPLQFENPDNPAAYYHTLAPEIVQELGTNLTSFVAGIGSGGTFAGMAKYLKERIPNIRLIGVEPEGSILNGGEPGPHEIEGIGVEFIPPFFANLDIDRFETISDEEGFSYTRKLAKKNGLLVGSSSGAAFAAALKEVQRLPEGSQVLTIFPDMADRYLSKGIYS

Atome Classification :

(67 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

KOU_A_3(3PC4)
?
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




PDA_A_2(2Q3D)
CYSK_MYCTU
[Raw transfer]




PUS_A_3(3X44)
?
[Raw transfer]




AA5_A_2(1Z7Y)
CYSK1_ARATH
[Raw transfer]




4AT_B_6(2EFY)
?
[Raw transfer]




CYS_A_2(4LMB)
?
[Raw transfer]




4AT_A_4(2EFY)
?
[Raw transfer]




AWH_A_3(3ZEI)
CYSK_MYCTU
[Raw transfer]




CIT_A_4(2V03)
CYSM_ECOLI
[Raw transfer]




CYS_B_11(3BM5)
?
[Raw transfer]




PLP_D_4(1D6S)
CYSK_SALTY
[Raw transfer]




PLP_E_5(1D6S)
CYSK_SALTY
[Raw transfer]




PLP_B_10(3BM5)
?
[Raw transfer]




4MV_A_3(2ECO)
?
[Raw transfer]




PLP_B_5(4L0D)
CBS_HUMAN
[Raw transfer]




PLP_A_3(4L0D)
CBS_HUMAN
[Raw transfer]




PLP_A_5(2PQM)
?
[Raw transfer]




PLP_B_7(4LMA)
?
[Raw transfer]




PLP_A_9(3BM5)
?
[Raw transfer]




PLP_D_16(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_3(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_B_18(4COO)
CBS_HUMAN
[Raw transfer]




PLP_A_5(4LMA)
?
[Raw transfer]




PLP_C_7(3VBE)
?
[Raw transfer]




PLP_A_2(2ECQ)
?
[Raw transfer]




PLP_B_6(2PQM)
?
[Raw transfer]




PLP_A_5(3VBE)
?
[Raw transfer]




PLP_A_5(2PQM)
?
[Raw transfer]




PLP_A_3(1Z7W)
CYSK1_ARATH
[Raw transfer]




PLP_B_5(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_B_6(3VBE)
?
[Raw transfer]




PLP_A_4(4PCU)
CBS_HUMAN
[Raw transfer]




PLP_B_4(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_A_3(1VE1)
?
[Raw transfer]




PLP_A_3(3PC2)
?
[Raw transfer]




PLP_B_7(4PCU)
CBS_HUMAN
[Raw transfer]




PLP_A_13(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_3(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_A_3(1VE1)
?
[Raw transfer]




PLP_A_4(4LMB)
?
[Raw transfer]




PLP_B_5(2EFY)
?
[Raw transfer]




PLP_A_5(4COO)
CBS_HUMAN
[Raw transfer]




PLP_A_3(1Z7W)
CYSK1_ARATH
[Raw transfer]




PLP_A_3(2EFY)
?
[Raw transfer]




PLP_A_2(2ECO)
?
[Raw transfer]




PLP_B_15(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_3(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_C_14(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_7(2ISQ)
CYSK1_ARATH
[Raw transfer]




PLP_D_8(3VBE)
?
[Raw transfer]




MPD_A_6(2Q3B)
CYSK_MYCTU
[Raw transfer]




PLP_B_8(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_D_11(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_A_7(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_C_9(2BHS)
CYSM_ECOLI
[Raw transfer]




MPD_A_6(2Q3B)
CYSK_MYCTU
[Raw transfer]




3HL_A_3(2ECQ)
?
[Raw transfer]




CHAIN_P_3(1Y7L)
CYSK_HAEIN
[Raw transfer]

-

MPD_A_4(2Q3B)
CYSK_MYCTU
[Raw transfer]




CHAIN_B_2(3TBH)
?
[Raw transfer]

-

CHAIN_B_3(2ISQ)
CYSK1_ARATH
[Raw transfer]

-

1 PsiBlast_PDB 98.1993% -76 - C3 -4R2V - CYSM_HELPY -
123 Fugue 75.2437% -58 - C3 -3PC3 8.4 ?
50 PsiBlast_CBE 74.9845% -73 - C3 -2ISQ 6.8 CYSK1_ARATH
105 HHSearch 74.9743% -61 * C3 *1Z7W 3.9 CYSK1_ARATH
49 PsiBlast_CBE 74.7445% -70 - C3 -1Z7W 3.9 CYSK1_ARATH
23 PsiBlast_CBE 74.3540% -65 - C3 -1M54 - CBS_HUMAN -
40 PsiBlast_CBE 74.2640% -63 - C3 -1JBQ - CBS_HUMAN -
16 PsiBlast_PDB 74.2341% -61 - C3 -4LMA 4.1 ?
9 PsiBlast_PDB 74.0840% -63 - C3 -1JBQ - CBS_HUMAN -
39 PsiBlast_CBE 73.9540% -63 - C3 -1JBQ - CBS_HUMAN -
30 PsiBlast_CBE 73.9540% -58 - C3 -4COO 4.7 CBS_HUMAN
38 PsiBlast_CBE 73.8640% -63 - C3 -1JBQ - CBS_HUMAN -
57 PsiBlast_CBE 73.8140% -66 - C3 -3VBE 3.9 ?
41 PsiBlast_CBE 73.8140% -63 - C3 -1JBQ - CBS_HUMAN -
26 PsiBlast_CBE 73.7840% -69 - C3 -1M54 - CBS_HUMAN -
22 PsiBlast_CBE 73.7140% -70 - C3 -1M54 - CBS_HUMAN -
56 PsiBlast_CBE 73.5340% -64 - C3 -3VBE 4.4 ?
37 PsiBlast_CBE 73.3940% -61 - C3 -1JBQ - CBS_HUMAN -
51 PsiBlast_CBE 73.3845% -70 - C3 -1Z7Y 3.7 CYSK1_ARATH
62 PsiBlast_CBE 73.3540% -61 - C3 -3VC3 - ? -
27 PsiBlast_CBE 73.2940% -60 - C3 -4L0D 3.3 CBS_HUMAN
6 PsiBlast_PDB 73.2840% -56 - C3 -4COO 4.5 CBS_HUMAN
112 HHSearch 73.2437% -57 - C3 -3PC3 8.4 ?
54 PsiBlast_CBE 73.1840% -66 - C3 -3VBE 4.1 ?
2 PsiBlast_PDB 73.1740% -62 - C3 -4PCU 3.7 CBS_HUMAN
21 PsiBlast_CBE 72.9740% -61 - C3 -4PCU 3.3 CBS_HUMAN
4 PsiBlast_PDB 72.9140% -57 - C3 -4L0D 3.6 CBS_HUMAN
60 PsiBlast_CBE 72.8837% -61 - C3 -3PC2 4.4 ?
59 PsiBlast_CBE 72.7237% -56 - C3 -3PC3 8.3 ?
47 PsiBlast_CBE 72.7141% -57 - C3 -4LMA 4.5 ?
55 PsiBlast_CBE 72.6840% -65 - C3 -3VBE 3.9 ?
58 PsiBlast_CBE 72.3337% -57 - C3 -3PC4 6.1 ?
12 PsiBlast_PDB 71.8442% -60 - C3 -2Q3D 8.0 CYSK_MYCTU
84 PsiBlast_CBE 71.6336% -68 - C3 -2PQM 3.6 ?
14 PsiBlast_PDB 71.3342% -66 - C3 -2Q3B 3.0 CYSK_MYCTU
87 PsiBlast_CBE 71.2336% -65 - C3 -3BM5 5.6 ?
101 HHSearch 71.1134% -58 - C3 -3X44 6.5 ?
11 PsiBlast_PDB 71.0142% -67 - C3 -3ZEI 6.0 CYSK_MYCTU
108 HHSearch 70.9138% -63 - C3 -1VE1 3.8 ?
86 PsiBlast_CBE 70.6636% -59 - C3 -3BM5 4.5 ?
52 PsiBlast_CBE 70.4642% -68 - C3 -4AEC 4.2 CYSKM_ARATH
110 HHSearch 70.2036% -63 - C3 -2PQM 4.2 ?
85 PsiBlast_CBE 70.1136% -62 - C3 -2PQM 4.2 ?
95 PsiBlast_CBE 69.9738% -56 - C3 -1D6S 4.9 CYSK_SALTY
121 Fugue 69.9437% -61 - C3 -1OAS 4.3 CYSK_SALTY
103 HHSearch 69.8342% -64 - C3 -2Q3B 2.6 CYSK_MYCTU
53 PsiBlast_CBE 69.8142% -68 - C3 -4AEC 3.7 CYSKM_ARATH
19 PsiBlast_PDB 69.8140% -56 - C3 -4LMB 4.1 ?
89 PsiBlast_CBE 69.1538% -60 - C3 -1OAS 4.0 CYSK_SALTY
96 PsiBlast_CBE 69.0938% -54 - C3 -1D6S 5.1 CYSK_SALTY
88 PsiBlast_CBE 69.0338% -61 - C3 -1OAS 3.8 CYSK_SALTY
106 HHSearch 68.9934% -62 - C3 -3TBH 3.9 ?
71 PsiBlast_CBE 68.9838% -62 - C3 -1VE1 3.8 ?
69 PsiBlast_CBE 68.8838% -60 - C3 -2ECQ 4.1 ?
70 PsiBlast_CBE 68.6638% -63 - C3 -2ECO 4.3 ?
67 PsiBlast_CBE 68.5838% -61 - C3 -2EFY 3.4 ?
107 HHSearch 68.4034% -64 - C3 -1Y7L 5.2 CYSK_HAEIN
68 PsiBlast_CBE 68.2938% -62 - C3 -2EFY 3.5 ?
92 PsiBlast_CBE 67.2838% -59 - C3 -1FCJ 3.5 CYSK_SALTY
90 PsiBlast_CBE 67.1838% -58 - C3 -1FCJ 4.0 CYSK_SALTY
93 PsiBlast_CBE 66.9638% -59 - C3 -1FCJ 3.6 CYSK_SALTY
91 PsiBlast_CBE 66.8538% -56 - C3 -1FCJ 3.0 CYSK_SALTY
72 PsiBlast_CBE 64.6635% -53 - C3 -2BHS 3.4 CYSM_ECOLI
73 PsiBlast_CBE 64.2935% -58 - C3 -2BHS 3.5 CYSM_ECOLI
75 PsiBlast_CBE 63.7635% -54 - C3 -2BHS 3.3 CYSM_ECOLI
94 PsiBlast_CBE 63.1734% -56 - C3 -2V03 3.5 CYSM_ECOLI
74 PsiBlast_CBE 62.9135% -54 - C3 -2BHS 3.5 CYSM_ECOLI