@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0181: (2015-12-13 )
MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNNIKQDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHNIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSNGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ

Atome Classification :

(70 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_5(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_C_9(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_B_5(4M89)
?
[Raw transfer]




NAD_B_5(4D46)
?
[Raw transfer]




NAD_B_7(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_D_11(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_B_7(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_D_11(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_A_3(4M89)
?
[Raw transfer]




NAD_B_5(1C14)
FABI_ECOLI
[Raw transfer]




NAD_A_3(4M87)
?
[Raw transfer]




NAD_D_9(2WYV)
?
[Raw transfer]




NAD_A_3(1C14)
FABI_ECOLI
[Raw transfer]




NAD_D_11(2PD3)
FABI_HELPY
[Raw transfer]




NAD_C_9(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_B_7(2PD3)
FABI_HELPY
[Raw transfer]




NAD_D_8(2PD4)
FABI_HELPY
[Raw transfer]




NAD_A_5(2PD4)
FABI_HELPY
[Raw transfer]




NDP_D_8(3OJF)
FABI_BACCR
[Raw transfer]




NAD_C_9(2PD3)
FABI_HELPY
[Raw transfer]




NAD_D_11(2WYW)
?
[Raw transfer]




NDP_C_12(3OJF)
FABI_BACCR
[Raw transfer]




NAD_A_5(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_A_5(2PD3)
FABI_HELPY
[Raw transfer]




NAD_B_6(2PD4)
FABI_HELPY
[Raw transfer]




NAD_A_5(2PD4)
FABI_HELPY
[Raw transfer]




NAD_D_11(2QIO)
?
[Raw transfer]




NAD_G_7(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_C_7(2PD4)
FABI_HELPY
[Raw transfer]




NAD_I_9(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_A_5(2QIO)
?
[Raw transfer]




NAD_C_9(2QIO)
?
[Raw transfer]




NDP_B_10(3OJF)
FABI_BACCR
[Raw transfer]




NAD_G_7(1I30)
FABI_ECOLI
[Raw transfer]




NAD_G_7(1LXC)
FABI_ECOLI
[Raw transfer]




NDP_A_6(3OJF)
FABI_BACCR
[Raw transfer]




NAD_I_9(1I2Z)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1I30)
FABI_ECOLI
[Raw transfer]




NAD_B_7(2QIO)
?
[Raw transfer]




IDN_M_13(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_B_5(3PJF)
FABI_ECOLI
[Raw transfer]




NAD_A_3(3PJE)
FABI_ECOLI
[Raw transfer]




0WE_A_4(4JQC)
FABI_ECOLI
[Raw transfer]




NAD_A_3(3PJD)
FABI_ECOLI
[Raw transfer]




NAD_A_3(4D46)
?
[Raw transfer]




AYM_I_9(1LXC)
FABI_ECOLI
[Raw transfer]




NAD_A_4(4JX8)
FABI_ECOLI
[Raw transfer]




AYM_K_11(1LXC)
FABI_ECOLI
[Raw transfer]




NAD_D_8(1DFI)
FABI_ECOLI
[Raw transfer]




NAI_B_5(4CV2)
?
[Raw transfer]




NAD_B_5(3PJE)
FABI_ECOLI
[Raw transfer]




NAD_B_5(3PJD)
FABI_ECOLI
[Raw transfer]




NAI_A_4(4CV3)
?
[Raw transfer]




NAI_A_2(4BKU)
?
[Raw transfer]




1S5_A_3(4BKU)
?
[Raw transfer]




NAD_E_5(1LX6)
FABI_ECOLI
[Raw transfer]




NAI_B_6(4CV3)
?
[Raw transfer]




NAD_E_5(1I2Z)
FABI_ECOLI
[Raw transfer]




AE6_A_3(4JX8)
FABI_ECOLI
[Raw transfer]




IDN_K_11(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_B_4(4M87)
?
[Raw transfer]




NAI_A_3(4CV2)
?
[Raw transfer]




GOL_B_11(3K2E)
?
[Raw transfer]




GOL_A_6(3K2E)
?
[Raw transfer]




NAD_I_9(1LX6)
FABI_ECOLI
[Raw transfer]




NAD_B_6(2WYV)
?
[Raw transfer]




NAD_A_3(4JQC)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1LXC)
FABI_ECOLI
[Raw transfer]




NAD_A_3(3PJF)
FABI_ECOLI
[Raw transfer]




NAD_A_2(4ZJU)
?
[Raw transfer]




GOL_C_8(2WYU)
?
[Raw transfer]




GOL_A_5(2WYU)
?
[Raw transfer]




NAD_A_5(1DFI)
FABI_ECOLI
[Raw transfer]




654_G_7(1I2Z)
FABI_ECOLI
[Raw transfer]




J47_A_4(4D46)
?
[Raw transfer]




826_K_11(1I30)
FABI_ECOLI
[Raw transfer]




TCL_C_10(2WYW)
?
[Raw transfer]




654_K_11(1I2Z)
FABI_ECOLI
[Raw transfer]




J47_B_6(4D46)
?
[Raw transfer]




826_I_9(1I30)
FABI_ECOLI
[Raw transfer]




EDO_A_5(3K31)
?
[Raw transfer]




EDO_A_4(3K2E)
?
[Raw transfer]




NAD_A_3(3K31)
?
[Raw transfer]




22 PsiBlast_CBE 95.8198%-119 - C1 -2PD4 10.8 FABI_HELPY
21 PsiBlast_CBE 95.6898%-120 - C1 -2PD4 10.6 FABI_HELPY
23 PsiBlast_CBE 95.5998%-121 - C1 -2PD4 10.6 FABI_HELPY
1 PsiBlast_PDB 95.4898%-118 - C1 -2PD3 9.9 FABI_HELPY
111 HHSearch 95.1898%-118 - C1 -2PD4 10.0 FABI_HELPY
2 PsiBlast_PDB 95.1898%-118 - C1 -2PD4 10.0 FABI_HELPY
24 PsiBlast_CBE 95.1498%-117 - C1 -2PD3 10.4 FABI_HELPY
25 PsiBlast_CBE 94.9998%-118 - C1 -2PD3 9.9 FABI_HELPY
26 PsiBlast_CBE 93.4798%-116 - C1 -2PD3 9.5 FABI_HELPY
4 PsiBlast_PDB 82.6052%-119 - C1 -3K2E 3.1 ?
5 PsiBlast_PDB 82.1152%-122 - C1 -3K31 4.4 ?
3 PsiBlast_PDB 80.8753%-118 - C1 -3GRK - ? -
28 PsiBlast_CBE 80.5552%-115 - C1 -3K2E 3.1 ?
27 PsiBlast_CBE 80.4852%-115 - C1 -3K31 - ? -
29 PsiBlast_CBE 79.6149%-117 - C1 -4M89 9.6 ?
63 PsiBlast_CBE 79.5346%-119 - C1 -3PJD 9.2 FABI_ECOLI
40 PsiBlast_CBE 79.4544%-118 - C1 -2WYV 9.7 ?
8 PsiBlast_PDB 79.4349%-117 - C1 -4M89 9.8 ?
58 PsiBlast_CBE 79.4247%-117 - C1 -4NR0 8.8 FABI_PSEAE
30 PsiBlast_CBE 79.2649%-122 - C1 -4M87 7.4 ?
9 PsiBlast_PDB 79.1349%-119 - C1 -4M87 8.9 ?
99 PsiBlast_CBE 79.0845%-118 - C1 -1QG6 9.5 FABI_ECOLI
97 PsiBlast_CBE 79.0545%-118 - C1 -1QG6 9.3 FABI_ECOLI
62 PsiBlast_CBE 78.8646%-119 - C1 -3PJD 9.7 FABI_ECOLI
59 PsiBlast_CBE 78.7847%-115 - C1 -4NR0 8.7 FABI_PSEAE
98 PsiBlast_CBE 78.6945%-118 - C1 -1QG6 9.5 FABI_ECOLI
61 PsiBlast_CBE 78.4947%-114 - C1 -4NR0 8.7 FABI_PSEAE
87 PsiBlast_CBE 78.4645%-120 - C1 -3PJE 9.5 FABI_ECOLI
96 PsiBlast_CBE 78.4345%-118 - C1 -1QG6 9.3 FABI_ECOLI
88 PsiBlast_CBE 78.3945%-118 - C1 -4D46 8.4 ?
37 PsiBlast_CBE 78.3944%-118 - C1 -2WYW 8.7 ?
83 PsiBlast_CBE 78.3045%-118 - C1 -1C14 8.5 FABI_ECOLI
32 PsiBlast_CBE 78.2745%-114 - C1 -3OJF 8.3 FABI_BACCR
91 PsiBlast_CBE 78.0345%-122 - C1 -4CV3 7.5 ?
57 PsiBlast_CBE 77.9945%-111 - C1 -2QIO 8.9 ?
90 PsiBlast_CBE 77.9645%-122 - C1 -4CV3 7.3 ?
54 PsiBlast_CBE 77.9345%-109 - C1 -2QIO 9.9 ?
81 PsiBlast_CBE 77.8945%-118 - C1 -1I2Z 8.9 FABI_ECOLI
42 PsiBlast_CBE 77.8844%-114 - C1 -2WYV 8.1 ?
89 PsiBlast_CBE 77.6745%-125 - C1 -4D46 7.6 ?
55 PsiBlast_CBE 77.5545%-110 - C1 -2QIO 9.1 ?
95 PsiBlast_CBE 77.5145%-118 - C1 -3PJF 8.5 FABI_ECOLI
80 PsiBlast_CBE 77.4745%-118 - C1 -1I2Z 9.3 FABI_ECOLI
82 PsiBlast_CBE 77.4445%-117 - C1 -1C14 8.8 FABI_ECOLI
72 PsiBlast_CBE 77.3745%-117 - C1 -1MFP 8.9 FABI_ECOLI
16 PsiBlast_PDB 77.3244%-114 - C1 -2WYU 1.9 ?
85 PsiBlast_CBE 77.2545%-119 - C1 -4JQC 8.6 FABI_ECOLI
73 PsiBlast_CBE 77.2145%-118 - C1 -1MFP 9.0 FABI_ECOLI
44 PsiBlast_CBE 77.2144%-110 - C1 -2WYU 2.5 ?
94 PsiBlast_CBE 77.1945%-116 - C1 -3PJF 9.7 FABI_ECOLI
60 PsiBlast_CBE 76.9847%-114 - C1 -4NR0 9.1 FABI_PSEAE
77 PsiBlast_CBE 76.9745%-119 - C1 -1LX6 7.4 FABI_ECOLI
93 PsiBlast_CBE 76.8945%-123 - C1 -4CV2 7.1 ?
38 PsiBlast_CBE 76.8644%-117 - C1 -2WYW 5.4 ?
33 PsiBlast_CBE 76.7845%-110 - C1 -3OJF 7.4 FABI_BACCR
56 PsiBlast_CBE 76.7345%-108 - C1 -2QIO 9.6 ?
74 PsiBlast_CBE 76.3745%-118 - C1 -1LXC 8.4 FABI_ECOLI
76 PsiBlast_CBE 76.2745%-119 - C1 -1LX6 7.1 FABI_ECOLI
86 PsiBlast_CBE 76.1745%-118 - C1 -3PJE 9.1 FABI_ECOLI
92 PsiBlast_CBE 75.9045%-123 - C1 -4CV2 7.5 ?
84 PsiBlast_CBE 75.8745%-116 - C1 -4JX8 8.1 FABI_ECOLI
13 PsiBlast_PDB 75.7648%-112 - C1 -4ZJU 6.6 ?
34 PsiBlast_CBE 75.7045%-110 - C1 -3OJF 10.7 FABI_BACCR
79 PsiBlast_CBE 75.6845%-116 - C1 -1I30 8.2 FABI_ECOLI
14 PsiBlast_PDB 75.4645%-111 - C1 -3OJF 9.8 FABI_BACCR
11 PsiBlast_PDB 75.1949%-117 - C1 -4BKU 8.7 ?
78 PsiBlast_CBE 75.0045%-116 - C1 -1I30 8.2 FABI_ECOLI
75 PsiBlast_CBE 75.0045%-117 - C1 -1LXC 8.3 FABI_ECOLI
100 PsiBlast_CBE 74.7445%-117 - C1 -1DFI 7.1 FABI_ECOLI
101 Fugue 70.9042%-132 - C1 -1DFI 5.8 FABI_ECOLI