@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0184: (2015-12-13 )
MKQRTLSIIKPDALKKKVVGKIIDRFESNGLEVVAMKRLHLSVKDAENFYAIHRERPFFKDLIEFMVSGPVVVMVLEGKDAVAKNRELMGATDPKLAQKGTIRADFAESIDANAVHGSDSLENAHNEIAFFFAAREF

Atome Classification :

(69 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_5(1WKL)
NDK_THET8
[Raw transfer]




ADP_A_3(4HR2)
NDK_BURTA
[Raw transfer]




GDP_A_8(2DXE)
NDK_PYRHO
[Raw transfer]




ATP_B_6(1WKL)
NDK_THET8
[Raw transfer]




ADP_R_5(1NLK)
NDK_MYXXA
[Raw transfer]




ADP_B_5(1NDP)
NDKC_DICDI
[Raw transfer]




ADP_R_5(1NLK)
NDK_MYXXA
[Raw transfer]




ADP_A_8(1KDN)
NDKC_DICDI
[Raw transfer]




PPS_A_4(1BUX)
NDKC_DICDI
[Raw transfer]




ADP_C_12(2BEF)
NDKC_DICDI
[Raw transfer]




ADP_B_4(4HR2)
NDK_BURTA
[Raw transfer]




ADP_B_10(2BEF)
NDKC_DICDI
[Raw transfer]




ADP_G_7(1ZS6)
NDK3_HUMAN
[Raw transfer]




ADP_B_10(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_C_12(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_G_7(1ZS6)
NDK3_HUMAN
[Raw transfer]




TBD_C_9(1F6T)
NDKC_DICDI
[Raw transfer]




ADP_I_9(1ZS6)
NDK3_HUMAN
[Raw transfer]




TYD_A_3(1NDC)
NDKC_DICDI
[Raw transfer]




ADP_K_11(1ZS6)
NDK3_HUMAN
[Raw transfer]




3AN_B_9(1HIY)
NDKC_DICDI
[Raw transfer]




ADP_A_8(2BEF)
NDKC_DICDI
[Raw transfer]




ADP_A_8(2DY9)
NDK_PYRHO
[Raw transfer]




ADP_A_9(2DYA)
NDK_PYRHO
[Raw transfer]




TBD_A_7(1F6T)
NDKC_DICDI
[Raw transfer]




TYD_A_3(3EVO)
NDK_MIMIV
[Raw transfer]




ADP_A_4(1NDP)
NDKC_DICDI
[Raw transfer]




3AN_A_7(1HIY)
NDKC_DICDI
[Raw transfer]




ADP_A_3(3NGU)
?
[Raw transfer]




GDP_G_7(1WKK)
NDK_THET8
[Raw transfer]




GDP_A_8(2DXE)
NDK_PYRHO
[Raw transfer]




ADP_B_4(3NGU)
?
[Raw transfer]




ADP_A_7(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_B_10(2DYA)
NDK_PYRHO
[Raw transfer]




PPS_B_5(1BUX)
NDKC_DICDI
[Raw transfer]




CIT_A_7(4ANE)
NDK_MYCTU
[Raw transfer]




TBD_B_8(1F6T)
NDKC_DICDI
[Raw transfer]




PPS_C_6(1BUX)
NDKC_DICDI
[Raw transfer]




SON_H_8(1S5Z)
NDKC_DICDI
[Raw transfer]




CIT_F_9(4ANE)
NDK_MYCTU
[Raw transfer]




3AN_C_11(1HIY)
NDKC_DICDI
[Raw transfer]




CIT_D_8(4ANE)
NDK_MYCTU
[Raw transfer]




GNP_A_7(2DXF)
NDK_PYRHO
[Raw transfer]




POP_H_8(1B99)
NDKC_DICDI
[Raw transfer]




CMP_R_3(1NHK)
NDK_MYXXA
[Raw transfer]




CMP_R_3(1NHK)
NDK_MYXXA
[Raw transfer]




ANP_A_5(2DXD)
NDK_PYRHO
[Raw transfer]




CMP_L_4(1NHK)
NDK_MYXXA
[Raw transfer]




ANP_B_6(2DXD)
NDK_PYRHO
[Raw transfer]




FUP_G_7(1B99)
NDKC_DICDI
[Raw transfer]




POP_I_9(1B99)
NDKC_DICDI
[Raw transfer]




POP_J_10(1B99)
NDKC_DICDI
[Raw transfer]




POP_L_12(1B99)
NDKC_DICDI
[Raw transfer]




POP_K_11(1B99)
NDKC_DICDI
[Raw transfer]




DTT_B_6(3NGS)
?
[Raw transfer]




EDO_B_7(4EK2)
NDK_BURTA
[Raw transfer]




42 PsiBlast_CBE 96.8973% -87 - C7 -3PJ9 - NDK_CAMJE -
43 PsiBlast_CBE 95.3473% -92 - C7 -3PJ9 - NDK_CAMJE -
22 PsiBlast_PDB 95.0873% -91 - C7 -3PJ9 - NDK_CAMJE -
24 PsiBlast_PDB 94.5170% -85 - C7 -4EK2 - NDK_BURTA -
49 PsiBlast_CBE 94.4265% -85 - C7 -1NHK 6.1 NDK_MYXXA
44 PsiBlast_CBE 94.1373% -86 - C7 -3PJ9 - NDK_CAMJE -
45 PsiBlast_CBE 92.7370% -84 - C7 -4HR2 6.0 NDK_BURTA
32 PsiBlast_PDB 92.7065% -88 - C7 -1NHK 5.9 NDK_MYXXA
5 HHSearch 92.7065% -90 - C7 -1NHK 5.9 NDK_MYXXA
46 PsiBlast_CBE 92.1370% -85 - C7 -4EK2 3.3 NDK_BURTA
30 PsiBlast_PDB 91.9365% -89 - C7 -2NCK - NDK_MYXXA -
25 PsiBlast_PDB 91.9370% -88 - C7 -4HR2 8.0 NDK_BURTA
26 PsiBlast_PDB 91.8967% -91 - C7 -3VGU - ? -
29 PsiBlast_PDB 91.6066% -88 - C7 -3VGT - ? -
48 PsiBlast_CBE 91.2265% -85 - C7 -1NLK - NDK_MYXXA -
47 PsiBlast_CBE 91.1170% -87 - C7 -4DUT - NDK_BURTA -
23 PsiBlast_PDB 91.0270% -88 - C7 -4DUT - NDK_BURTA -
27 PsiBlast_PDB 90.8467% -83 - C7 -3VGV - ? -
28 PsiBlast_PDB 90.6066% -83 - C7 -3VGS - ? -
31 PsiBlast_PDB 90.3765% -88 - C7 -1NLK 5.8 NDK_MYXXA
123 Fugue 90.3164% -88 - C7 -1NLK 5.8 NDK_MYXXA
60 PsiBlast_CBE 87.1050% -95 - C7 -2DYA 6.6 NDK_PYRHO
64 PsiBlast_CBE 86.8950% -97 - C7 -2DXF 4.3 NDK_PYRHO
66 PsiBlast_CBE 86.8450% -95 - C7 -2DXE 6.0 NDK_PYRHO
40 PsiBlast_PDB 86.3251%-104 - C7 -1WKL 5.8 NDK_THET8
62 PsiBlast_CBE 86.1950% -96 - C7 -2DY9 6.1 NDK_PYRHO
68 PsiBlast_CBE 86.1550%-100 - C7 -2DXD 4.5 NDK_PYRHO
39 PsiBlast_PDB 85.9951% -95 - C7 -1WKK 4.8 NDK_THET8
21 HHSearch 85.4451% -93 - C7 -2DXE 7.3 NDK_PYRHO
59 PsiBlast_CBE 85.1950% -97 - C7 -2DYA 5.6 NDK_PYRHO
67 PsiBlast_CBE 85.0050% -99 - C7 -2DXD 5.1 NDK_PYRHO
57 PsiBlast_CBE 84.5051%-103 - C7 -1WKL 5.3 NDK_THET8
94 PsiBlast_CBE 83.9545%-100 - C7 -1ZS6 6.2 NDK3_HUMAN
93 PsiBlast_CBE 83.2045% -97 - C7 -1ZS6 6.2 NDK3_HUMAN
102 PsiBlast_CBE 83.0645% -91 - C7 -1NDP 7.4 NDKC_DICDI
116 PsiBlast_CBE 82.9245% -92 - C7 -1BUX 6.6 NDKC_DICDI
14 HHSearch 82.4546% -95 - C7 -1ZS6 6.9 NDK3_HUMAN
117 PsiBlast_CBE 82.1945% -93 - C7 -1B99 3.4 NDKC_DICDI
121 PsiBlast_CBE 82.1745% -92 - C7 -1B99 3.2 NDKC_DICDI
104 PsiBlast_CBE 82.1645% -91 - C7 -1NDC 6.8 NDKC_DICDI
122 PsiBlast_CBE 82.1245% -90 * C7 *1B99 5.1 NDKC_DICDI
90 PsiBlast_CBE 82.0446% -87 - C7 -3NGS 1.8 ?
120 PsiBlast_CBE 81.8445% -91 - C7 -1B99 2.0 NDKC_DICDI
114 PsiBlast_CBE 81.7845% -91 - C7 -1BUX 5.1 NDKC_DICDI
95 PsiBlast_CBE 81.7845% -97 - C7 -1ZS6 6.9 NDK3_HUMAN
119 PsiBlast_CBE 81.4745% -94 - C7 -1B99 3.7 NDKC_DICDI
101 PsiBlast_CBE 81.4045% -94 - C7 -1S5Z 5.3 NDKC_DICDI
106 PsiBlast_CBE 81.3445% -91 - C7 -1KDN 6.4 NDKC_DICDI
98 PsiBlast_CBE 81.2745% -88 - C7 -2BEF 7.0 NDKC_DICDI
118 PsiBlast_CBE 81.1445% -91 - C7 -1B99 3.2 NDKC_DICDI
111 PsiBlast_CBE 81.0245% -90 - C7 -1F6T 6.7 NDKC_DICDI
113 PsiBlast_CBE 80.8345% -88 - C7 -1F6T 7.0 NDKC_DICDI
96 PsiBlast_CBE 80.7945% -89 - C7 -2BEF 7.0 NDKC_DICDI
73 PsiBlast_CBE 80.6147% -82 - C7 -4ANE 3.1 NDK_MYCTU
110 PsiBlast_CBE 80.5745% -83 - C7 -1HIY 5.6 NDKC_DICDI
107 PsiBlast_CBE 80.5645% -88 - C7 -1KDN 7.4 NDKC_DICDI
74 PsiBlast_CBE 80.4746% -91 - C7 -3NGU 5.7 ?
105 PsiBlast_CBE 80.4545% -89 - C7 -1KDN 6.7 NDKC_DICDI
16 HHSearch 80.4542% -94 - C7 -3Q8U 6.5 NDK_STAAC
115 PsiBlast_CBE 80.4145% -87 - C7 -1BUX 5.2 NDKC_DICDI
75 PsiBlast_CBE 80.0746% -83 - C7 -3NGU 8.0 ?
112 PsiBlast_CBE 80.0245% -87 - C7 -1F6T 6.9 NDKC_DICDI
10 HHSearch 79.9940% -91 - C7 -3EVO 5.0 NDK_MIMIV
97 PsiBlast_CBE 79.7845% -87 - C7 -2BEF 6.5 NDKC_DICDI
109 PsiBlast_CBE 79.6245% -92 - C7 -1HIY 5.0 NDKC_DICDI
108 PsiBlast_CBE 78.9545% -96 - C7 -1HIY 5.3 NDKC_DICDI
72 PsiBlast_CBE 78.8747% -78 - C7 -4ANE 3.5 NDK_MYCTU
103 PsiBlast_CBE 78.7945% -86 - C7 -1NDP 6.8 NDKC_DICDI
71 PsiBlast_CBE 76.8347% -78 - C7 -4ANE 3.4 NDK_MYCTU