@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0266: (2015-12-14 )
MDFQLQAVDDNARAGVLNLAHSQVETPVFMPVGTQGCIKSLDAMDAQEILGAKLILANTYHMYLRPGEKVVEQLGGLHRFAQFQGSFLTDSGGFQAFSLSDNVKLQEDGIVFKSHIDGSKHLFTPIKVLDIQYSLNSDIMMVLDDLVGLPAPLKRLEESIKRSAKWANMSLEYHKENNRPNNNLFAIIQGGTHLKMRSLSVGLTHEGFDGYAIGGLAVGESVDEMLETIAHTAPLLPKDKPRYLMGVGTPENILDAISLGVDMFDCVMPTRNARNATLFTHSGKISIKNAPYKLDDTPIEENCACYACKRYSKAYLHHLFRAKELTYARLASLHNLHFYLELVKNARNAILEKRFLSFKKEFLEKYHSCSH

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0EX_A_2(4GI4)
TGT_ZYMMO
[Raw transfer]




PK2_A_3(3EOS)
TGT_ZYMMO
[Raw transfer]




0O1_A_4(4GKT)
TGT_ZYMMO
[Raw transfer]




0V2_A_3(4FR1)
TGT_ZYMMO
[Raw transfer]




0V3_A_3(4FR6)
TGT_ZYMMO
[Raw transfer]




CKR_A_6(4Q8P)
TGT_ZYMMO
[Raw transfer]




0WY_A_3(4GIY)
TGT_ZYMMO
[Raw transfer]




AFQ_A_3(3GE7)
TGT_ZYMMO
[Raw transfer]




AAQ_A_2(3GC4)
TGT_ZYMMO
[Raw transfer]




AEK_A_3(3SM0)
TGT_ZYMMO
[Raw transfer]




2MQ_A_3(3GC5)
TGT_ZYMMO
[Raw transfer]




0WX_A_3(4GH1)
TGT_ZYMMO
[Raw transfer]




CKR_A_7(4Q8O)
TGT_ZYMMO
[Raw transfer]




CKR_A_8(4PUJ)
TGT_ZYMMO
[Raw transfer]




0EV_A_3(4GH3)
TGT_ZYMMO
[Raw transfer]




PK3_A_3(3EOU)
TGT_ZYMMO
[Raw transfer]




2WU_A_5(4PUM)
TGT_ZYMMO
[Raw transfer]




AIQ_A_3(1K4G)
TGT_ZYMMO
[Raw transfer]




GOL_A_7(4IPP)
TGT_ZYMMO
[Raw transfer]




PQ0_A_3(2QII)
TGT_ZYMMO
[Raw transfer]




2WU_A_4(4PUL)
TGT_ZYMMO
[Raw transfer]




GOL_A_8(2NQZ)
TGT_ZYMMO
[Raw transfer]




GOL_A_5(2QII)
TGT_ZYMMO
[Raw transfer]




GOL_A_9(4Q8M)
TGT_ZYMMO
[Raw transfer]




S60_A_3(3C2Y)
TGT_ZYMMO
[Raw transfer]




GOL_A_4(4L56)
TGT_ZYMMO
[Raw transfer]




HRD_A_3(3RR4)
TGT_ZYMMO
[Raw transfer]




GUN_A_3(2PWU)
TGT_ZYMMO
[Raw transfer]




PRF_A_3(2NQZ)
TGT_ZYMMO
[Raw transfer]




PRF_A_3(1PXG)
TGT_ZYMMO
[Raw transfer]




39 PsiBlast_CBE 97.1743% -94 - C4 -3SM0 6.5 TGT_ZYMMO
19 PsiBlast_PDB 96.7843% -89 - C4 -1S38 - TGT_ZYMMO -
14 PsiBlast_PDB 96.5443% -88 - C4 -1P0B - TGT_ZYMMO -
58 PsiBlast_CBE 96.4543% -88 - C4 -4LEQ - TGT_ZYMMO -
78 PsiBlast_CBE 96.3543% -89 - C4 -4HSH - TGT_ZYMMO -
57 PsiBlast_CBE 96.3243% -88 - C4 -4Q8V - TGT_ZYMMO -
75 PsiBlast_CBE 96.3143% -87 - C4 -1EFZ - TGT_ZYMMO -
87 PsiBlast_CBE 96.3043% -89 - C4 -4DXX - TGT_ZYMMO -
27 PsiBlast_CBE 96.2243% -90 - C4 -4Q4O - TGT_ZYMMO -
47 PsiBlast_CBE 96.2143% -87 - C4 -2QII 4.0 TGT_ZYMMO
20 PsiBlast_PDB 96.1543% -91 - C4 -2BBF - TGT_ZYMMO -
67 PsiBlast_CBE 96.1143% -89 - C4 -4HQV - TGT_ZYMMO -
1 PsiBlast_PDB 96.0843% -91 - C4 -4GD0 - TGT_ZYMMO -
82 PsiBlast_CBE 96.0543% -90 - C4 -4Q8M 2.8 TGT_ZYMMO
59 PsiBlast_CBE 96.0543% -90 - C4 -4LBU - TGT_ZYMMO -
17 PsiBlast_PDB 96.0543% -87 - C4 -1Q65 - TGT_ZYMMO -
91 PsiBlast_CBE 95.9943% -89 * C4 *4Q8P 5.1 TGT_ZYMMO
5 PsiBlast_PDB 95.9643% -87 - C4 -1OZM - TGT_ZYMMO -
35 PsiBlast_CBE 95.9043% -92 - C4 -4GH3 5.4 TGT_ZYMMO
18 PsiBlast_PDB 95.8843% -93 - C4 -1Q66 - TGT_ZYMMO -
46 PsiBlast_CBE 95.8343% -87 - C4 -3C2Y 5.4 TGT_ZYMMO
36 PsiBlast_CBE 95.6343% -92 - C4 -4GH1 6.3 TGT_ZYMMO
88 PsiBlast_CBE 95.5843% -88 - C4 -4IPP 2.6 TGT_ZYMMO
81 PsiBlast_CBE 95.4843% -91 - C4 -4Q8O 4.9 TGT_ZYMMO
32 PsiBlast_CBE 95.2743% -92 - C4 -4GKT 2.6 TGT_ZYMMO
41 PsiBlast_CBE 95.2443% -91 - C4 -3GE7 4.4 TGT_ZYMMO
42 PsiBlast_CBE 95.0843% -89 - C4 -3GC5 5.1 TGT_ZYMMO
31 PsiBlast_CBE 94.8843% -91 - C4 -4PUJ 4.9 TGT_ZYMMO
85 PsiBlast_CBE 94.8743% -90 - C4 -4PUL 5.1 TGT_ZYMMO
86 PsiBlast_CBE 94.8243% -89 - C4 -4PUM 5.4 TGT_ZYMMO
45 PsiBlast_CBE 94.7743% -96 - C4 -3EOS 5.2 TGT_ZYMMO
124 Fugue 94.7043% -91 - C4 -1K4G 4.4 TGT_ZYMMO
83 PsiBlast_CBE 94.5443% -92 - C4 -2NQZ 4.5 TGT_ZYMMO
43 PsiBlast_CBE 94.4343% -88 - C4 -3GC4 0.7 TGT_ZYMMO
38 PsiBlast_CBE 94.3943% -94 - C4 -4FR1 6.0 TGT_ZYMMO
34 PsiBlast_CBE 94.1043% -91 - C4 -4GI4 5.9 TGT_ZYMMO
44 PsiBlast_CBE 93.7743% -93 - C4 -3EOU 5.1 TGT_ZYMMO
48 PsiBlast_CBE 93.7443% -88 - C4 -2PWU 3.9 TGT_ZYMMO
40 PsiBlast_CBE 93.6743% -89 - C4 -3RR4 4.5 TGT_ZYMMO
84 PsiBlast_CBE 93.1743% -92 - C4 -1PXG 3.8 TGT_ZYMMO
37 PsiBlast_CBE 93.1543% -97 - C4 -4FR6 6.1 TGT_ZYMMO
92 PsiBlast_CBE 92.8943% -96 - C4 -4L56 3.2 TGT_ZYMMO
33 PsiBlast_CBE 91.6843% -94 - C4 -4GIY 6.3 TGT_ZYMMO