@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0291: (2015-12-14 )
MELLHSINDFNEAKQVIAGGVNSPVRAFKSVKGTPPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFGHADEEIEENIINVLKKGTSFGAPTELETTLAKEIISCYEGLDKVRLVNSGTEATMSAIRLARAYSQKDDLIKFEGCYHGHSDSLLVKAGSGCATFGSPSSLGVPNDFSKHTLVARYNDLNSTEECFKKGDVGCVIIEPIAGNMGLVPAQKEFLLGLKALCEKYQAVLILDEVMSGFRASLSGSQEFYGVVPDLVTFGKVIGAGLPLACFGGRAEIMDLLSPIGGVYQAGTLSGNPLAVCAGLSALYKIKRDKTLYTRLNALAVRLTQGLQKSAQNYNIALETLNMGSMFGFFFNENAVRDFDDALKSDTEMFAKFHQKMLFKGVYLACSSFETGFICEPMTEEMIDLAISKADESFDEIINGV

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PXG_A_3(3FQ7)
GSA_SYNP6
[Raw transfer]




EA5_A_3(2HP1)
GSA_SYNP6
[Raw transfer]




KE4_A_3(2HP2)
GSA_SYNP6
[Raw transfer]




PXG_B_4(3FQ7)
GSA_SYNP6
[Raw transfer]




PMP_E_5(3GSB)
GSA_SYNP6
[Raw transfer]




PMP_A_3(2HOZ)
GSA_SYNP6
[Raw transfer]




PMP_B_4(2HOZ)
GSA_SYNP6
[Raw transfer]




PMP_A_2(3BS8)
GSA_BACSU
[Raw transfer]




PMP_A_3(3FQA)
GSA_SYNP6
[Raw transfer]




PMP_B_5(3FQA)
GSA_SYNP6
[Raw transfer]




PMP_B_4(3FQ8)
GSA_SYNP6
[Raw transfer]




PMP_A_3(2GSA)
GSA_SYNP6
[Raw transfer]




PMP_C_8(2ZSM)
GSA_AERPE
[Raw transfer]




PLR_B_5(3USF)
GSA_SYNE7
[Raw transfer]




PMP_A_3(3FQ8)
GSA_SYNP6
[Raw transfer]




PLR_A_3(3USF)
GSA_SYNE7
[Raw transfer]




PMP_A_2(2EPJ)
GSA_AERPE
[Raw transfer]




PMP_B_6(2ZSM)
GSA_AERPE
[Raw transfer]




PMP_A_2(2ZSL)
GSA_AERPE
[Raw transfer]




PMP_A_2(2EPJ)
GSA_AERPE
[Raw transfer]




PMP_A_3(3FQ8)
GSA_SYNP6
[Raw transfer]




PMP_C_3(3GSB)
GSA_SYNP6
[Raw transfer]




PMP_A_4(2E7U)
GSA_THET8
[Raw transfer]




PMP_A_4(2E7U)
GSA_THET8
[Raw transfer]




PLP_B_4(2GSA)
GSA_SYNP6
[Raw transfer]




PLR_A_3(2CFB)
GSA_THEEB
[Raw transfer]




PLP_B_4(2HP2)
GSA_SYNP6
[Raw transfer]




PMP_A_4(2ZSM)
GSA_AERPE
[Raw transfer]




PLP_B_4(2HP1)
GSA_SYNP6
[Raw transfer]




PLP_B_4(4GSA)
GSA_SYNP6
[Raw transfer]




PLP_A_3(4GSA)
GSA_SYNP6
[Raw transfer]




GAB_D_4(3GSB)
GSA_SYNP6
[Raw transfer]




GAB_A_4(3FQA)
GSA_SYNP6
[Raw transfer]




HOZ_A_4(3USF)
GSA_SYNE7
[Raw transfer]




HOZ_B_5(2HP1)
GSA_SYNP6
[Raw transfer]




1 PsiBlast_PDB 95.2249% -99 - C1 -3BS8 3.9 GSA_BACSU
28 PsiBlast_CBE 94.6048%-110 - C1 -3USF 4.3 GSA_SYNE7
7 PsiBlast_PDB 94.2348%-106 - C1 -2HOZ 4.4 GSA_SYNP6
21 PsiBlast_CBE 94.1249%-100 - C1 -4GSA 3.2 GSA_SYNP6
23 PsiBlast_CBE 93.7649%-100 - C1 -2GSA 3.4 GSA_SYNP6
82 Fugue 93.5547% -97 - C1 -2GSA 5.1 GSA_SYNP6
27 PsiBlast_CBE 93.1848%-110 - C1 -2HOY - GSA_SYNP6 -
31 PsiBlast_CBE 93.0648%-103 - C1 -3FQ8 4.0 GSA_SYNP6
12 PsiBlast_PDB 92.9548%-104 - C1 -3FQA 4.1 GSA_SYNP6
3 PsiBlast_PDB 92.9449%-100 - C1 -2GSA - GSA_SYNP6 -
10 PsiBlast_PDB 92.9248%-102 - C1 -3FQ7 5.6 GSA_SYNP6
30 PsiBlast_CBE 92.8148%-101 - C1 -3FQA 4.4 GSA_SYNP6
4 PsiBlast_PDB 92.4649%-101 - C1 -4GSA 3.1 GSA_SYNP6
26 PsiBlast_CBE 92.3548%-104 - C1 -2HOZ 4.4 GSA_SYNP6
13 PsiBlast_PDB 92.3348%-104 - C1 -3FQ8 4.9 GSA_SYNP6
22 PsiBlast_CBE 92.2049%-101 - C1 -3GSB 4.8 GSA_SYNP6
8 PsiBlast_PDB 92.0348%-102 - C1 -2HP1 5.4 GSA_SYNP6
9 PsiBlast_PDB 91.9648%-101 - C1 -2HP2 5.1 GSA_SYNP6
61 HHSearch 91.9547%-101 * C1 *3FQ8 4.9 GSA_SYNP6
11 PsiBlast_PDB 91.9048%-102 - C1 -3USF 4.4 GSA_SYNE7
29 PsiBlast_CBE 91.6848%-101 - C1 -3FQ7 5.9 GSA_SYNP6
24 PsiBlast_CBE 91.3048%-101 - C1 -2HP2 3.7 GSA_SYNP6
25 PsiBlast_CBE 91.1448%-110 - C1 -2HP1 3.0 GSA_SYNP6
5 PsiBlast_PDB 91.0849%-101 - C1 -3GSB 4.4 GSA_SYNP6
59 HHSearch 89.8746% -98 - C1 -2E7U 4.3 GSA_THET8
2 PsiBlast_PDB 88.7547%-103 - C1 -2E7U 4.3 GSA_THET8
14 PsiBlast_PDB 86.9648%-109 - C1 -2CFB 2.8 GSA_THEEB
65 HHSearch 79.7738% -91 - C1 -2EPJ 4.8 GSA_AERPE
32 PsiBlast_CBE 79.3938% -94 - C1 -2ZSM 4.2 GSA_AERPE
33 PsiBlast_CBE 78.5738% -97 - C1 -2ZSM 4.2 GSA_AERPE
15 PsiBlast_PDB 77.2638% -92 - C1 -2EPJ 4.8 GSA_AERPE
17 PsiBlast_PDB 77.0038% -94 - C1 -2ZSM 4.3 GSA_AERPE
16 PsiBlast_PDB 76.7338% -92 - C1 -2ZSL 4.8 GSA_AERPE