Study : jhp_0373 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C13_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C13_S1
Complex: AI7_B_12(2O3Z) / Model_53(2O3Z/B) = [3.4] Download761.5829.96MKQTTINHSVELVGIGLHKGVPVKLVLEPLEENQGIVFYRSDLGVKLPLKPENIVDTKMATVLGKDNARISTIEHLLSAVHAYGIDNLKISVDNEEIPIMDGSALTYCMLLDEAGIKELDAPKKVMEIKQAVEVREGDKFVKIEPDSQLSLNFTIDFNHPVIAKQAHHFVFSKTAYKEQVAKARTFGFLQEVNYLRSIGLAKGGSLNNCIVLDENSILNKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKAILADAKNYEVLIASDPAKEFALQKAFA
Complex: MYR_A_10(1P42) / Model_19(1P42/A) = [3.6] Download1001.6720.67MKQTTINHSVELVGIGLHKGVPVKLVLEPLEENQGIVFYRSDLGVKLPLKPENIVDTKMATVLGKDNARISTIEHLLSAVHAYGIDNLKISVDNEEIPIMDGSALTYCMLLDEAGIKELDAPKKVMEIKQAVEVREGDKFVKIEPDSQLSLNFTIDFNHPVIAKQAHHFVFSKTAYKEQVAKARTFGFLQEVNYLRSIGLAKGGSLNNCIVLDENSILNKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKAILADAKNYEVLIASDPAKEFALQKAFA
Complex: MYR_A_10(1P42) / Model_78(1P42/A) = [3.6] Download993.5820.67MKQTTINHSVELVGIGLHKGVPVKLVLEPLEENQGIVFYRSDLGVKLPLKPENIVDTKMATVLGKDNARISTIEHLLSAVHAYGIDNLKISVDNEEIPIMDGSALTYCMLLDEAGIKELDAPKKVMEIKQAVEVREGDKFVKIEPDSQLSLNFTIDFNHPVIAKQAHHFVFSKTAYKEQVAKARTFGFLQEVNYLRSIGLAKGGSLNNCIVLDENSILNKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKAILADAKNYEVLIASDPAKEFALQKAFA
Complex: MYR_B_11(2GO3) / Model_63(2GO3/B) = [3.7] Download1186.7933.59MKQTTINHSVELVGIGLHKGVPVKLVLEPLEENQGIVFYRSDLGVKLPLKPENIVDTKMATVLGKDNARISTIEHLLSAVHAYGIDNLKISVDNEEIPIMDGSALTYCMLLDEAGIKELDAPKKVMEIKQAVEVREGDKFVKIEPDSQLSLNFTIDFNHPVIAKQAHHFVFSKTAYKEQVAKARTFGFLQEVNYLRSIGLAKGGSLNNCIVLDENSILNKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKAILADAKNYEVLIASDPAKEFALQKAFA
Complex: PAM_B_15(1YHC) / Model_46(1YHC/B) = [3.7] Download1220.2630.91MKQTTINHSVELVGIGLHKGVPVKLVLEPLEENQGIVFYRSDLGVKLPLKPENIVDTKMATVLGKDNARISTIEHLLSAVHAYGIDNLKISVDNEEIPIMDGSALTYCMLLDEAGIKELDAPKKVMEIKQAVEVREGDKFVKIEPDSQLSLNFTIDFNHPVIAKQAHHFVFSKTAYKEQVAKARTFGFLQEVNYLRSIGLAKGGSLNNCIVLDENSILNKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKAILADAKNYEVLIASDPAKEFALQKAFA
Consensus
[pKd Mean = 3.60]
-1032
(s=164)
27
(s=5)
MKQTTINHSVELVGIGLHKGVPVKLVLEPLEENQGIVFYRSDLGVKLPLKPENIVDTKMATVLGKDNARISTIEHLLSAVHAYGIDNLKISVDNEEIPIMDGSALTYCMLLDEAGIKELDAPKKVMEIKQAVEVREGDKFVKIEPDSQLSLNFTIDFNHPVIAKQAHHFVFSKTAYKEQVAKARTFGFLQEVNYLRSIGLAKGGSLNNCIVLDENSILNKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKAILADAKNYEVLIASDPAKEFALQKAFA