@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0373: (2015-12-14 )
MKQTTINHSVELVGIGLHKGVPVKLVLEPLEENQGIVFYRSDLGVKLPLKPENIVDTKMATVLGKDNARISTIEHLLSAVHAYGIDNLKISVDNEEIPIMDGSALTYCMLLDEAGIKELDAPKKVMEIKQAVEVREGDKFVKIEPDSQLSLNFTIDFNHPVIAKQAHHFVFSKTAYKEQVAKARTFGFLQEVNYLRSIGLAKGGSLNNCIVLDENSILNKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKAILADAKNYEVLIASDPAKEFALQKAFA

Atome Classification :

(67 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

24G_A_6(4MDT)
?
[Raw transfer]




24G_D_15(4MDT)
?
[Raw transfer]




1WM_A_4(4LCG)
LPXC_PSEAE
[Raw transfer]




L59_B_15(4FW6)
LPXC_PSEAE
[Raw transfer]




L59_C_24(4FW6)
LPXC_PSEAE
[Raw transfer]




24G_B_13(4OZE)
LPXC_AQUAE
[Raw transfer]




L63_C_25(4FW7)
LPXC_PSEAE
[Raw transfer]




1JS_A_5(4J3D)
LPXC_PSEAE
[Raw transfer]




1WN_A_5(4LCH)
LPXC_PSEAE
[Raw transfer]




L63_A_6(4FW7)
LPXC_PSEAE
[Raw transfer]




L59_A_6(4FW6)
LPXC_PSEAE
[Raw transfer]




L58_C_16(4FW5)
LPXC_PSEAE
[Raw transfer]




P76_A_3(3P76)
LPXC_AQUAE
[Raw transfer]




L52_A_6(4FW3)
LPXC_PSEAE
[Raw transfer]




L63_B_15(4FW7)
LPXC_PSEAE
[Raw transfer]




1JS_B_8(4J3D)
LPXC_PSEAE
[Raw transfer]




2CW_A_3(4MQY)
?
[Raw transfer]




24G_B_9(4MDT)
?
[Raw transfer]




2SZ_A_4(4OKG)
LPXC_PSEAE
[Raw transfer]




2SZ_B_6(4OKG)
LPXC_PSEAE
[Raw transfer]




L52_D_13(4FW3)
LPXC_PSEAE
[Raw transfer]




L52_C_11(4FW3)
LPXC_PSEAE
[Raw transfer]




C90_A_3(3NZK)
?
[Raw transfer]




TUX_B_10(2GO4)
LPXC_AQUAE
[Raw transfer]




24G_C_12(4MDT)
?
[Raw transfer]




C90_B_6(3NZK)
?
[Raw transfer]




3P3_C_11(4FW4)
LPXC_PSEAE
[Raw transfer]




3P3_D_15(4FW4)
LPXC_PSEAE
[Raw transfer]




L52_B_9(4FW3)
LPXC_PSEAE
[Raw transfer]




L58_D_20(4FW5)
LPXC_PSEAE
[Raw transfer]




3BX_A_6(4U3D)
LPXC_AQUAE
[Raw transfer]




L58_B_10(4FW5)
LPXC_PSEAE
[Raw transfer]




3P3_A_6(4FW4)
LPXC_PSEAE
[Raw transfer]




GVR_A_3(4ISA)
?
[Raw transfer]




TUX_A_9(2GO4)
LPXC_AQUAE
[Raw transfer]




3P3_B_8(4FW4)
LPXC_PSEAE
[Raw transfer]




1WL_A_4(4LCF)
LPXC_PSEAE
[Raw transfer]




L58_A_6(4FW5)
LPXC_PSEAE
[Raw transfer]




GVR_C_12(2VES)
LPXC_PSEAE
[Raw transfer]




RFN_A_3(3UHM)
LPXC_PSEAE
[Raw transfer]




RFN_A_3(3UHM)
LPXC_PSEAE
[Raw transfer]




GVR_A_5(2VES)
LPXC_PSEAE
[Raw transfer]




03I_B_6(3U1Y)
LPXC_PSEAE
[Raw transfer]




3BW_A_7(4U3B)
LPXC_AQUAE
[Raw transfer]




GVR_B_8(2VES)
LPXC_PSEAE
[Raw transfer]




LTF_B_7(4IS9)
?
[Raw transfer]




PLM_B_12(2IES)
LPXC_AQUAE
[Raw transfer]




PAM_B_12(1YH8)
LPXC_AQUAE
[Raw transfer]




LTF_A_5(4IS9)
?
[Raw transfer]




PLM_A_8(2IES)
LPXC_AQUAE
[Raw transfer]




MYR_A_10(1P42)
LPXC_AQUAE
[Raw transfer]




MYR_A_10(1P42)
LPXC_AQUAE
[Raw transfer]




FMT_A_9(4ISA)
?
[Raw transfer]




MYR_B_11(1P42)
LPXC_AQUAE
[Raw transfer]




AI7_B_12(2O3Z)
LPXC_AQUAE
[Raw transfer]




PAM_B_15(1YHC)
LPXC_AQUAE
[Raw transfer]




MYR_B_11(2GO3)
LPXC_AQUAE
[Raw transfer]




UDP_B_13(2IER)
LPXC_AQUAE
[Raw transfer]




UDP_A_12(2IER)
LPXC_AQUAE
[Raw transfer]




MYR_B_16(2J65)
LPXC_AQUAE
[Raw transfer]




PLM_A_10(2GO3)
LPXC_AQUAE
[Raw transfer]




MYR_B_16(2J65)
LPXC_AQUAE
[Raw transfer]




24G_B_13(4OZE)
LPXC_AQUAE
[Raw transfer]




PAM_B_15(1YHC)
LPXC_AQUAE
[Raw transfer]




AI7_B_12(2O3Z)
LPXC_AQUAE
[Raw transfer]




24G_B_13(4OZE)
LPXC_AQUAE
[Raw transfer]




PAM_B_12(1YH8)
LPXC_AQUAE
[Raw transfer]




42 PsiBlast_CBE 97.8243%-100 - C13 -4MDT 5.6 ?
14 PsiBlast_PDB 96.9943%-100 - C13 -4MDT 6.2 ?
15 PsiBlast_PDB 96.9743%-101 - C13 -4MQY 6.4 ?
17 PsiBlast_PDB 96.6943%-100 - C13 -4ISA 5.8 ?
41 PsiBlast_CBE 96.4943% -99 - C13 -4MDT 4.9 ?
44 PsiBlast_CBE 96.3643%-100 - C13 -4IS9 4.9 ?
16 PsiBlast_PDB 96.2243% -99 - C13 -4IS9 4.8 ?
43 PsiBlast_CBE 96.1543%-102 - C13 -4MDT 5.2 ?
45 PsiBlast_CBE 95.4541% -97 - C13 -3NZK 6.8 ?
32 PsiBlast_CBE 94.7644%-100 - C13 -4FW5 7.6 LPXC_PSEAE
34 PsiBlast_CBE 94.7544%-101 - C13 -4FW4 7.2 LPXC_PSEAE
25 PsiBlast_CBE 94.6644% -99 - C13 -4FW7 - LPXC_PSEAE -
24 PsiBlast_CBE 94.6644%-100 - C13 -2VES 6.2 LPXC_PSEAE
1 PsiBlast_PDB 94.6044% -98 - C13 -2VES 6.0 LPXC_PSEAE
31 PsiBlast_CBE 94.5744% -98 - C13 -4FW5 7.9 LPXC_PSEAE
39 PsiBlast_CBE 94.5544%-104 - C13 -4FW3 7.1 LPXC_PSEAE
9 PsiBlast_PDB 94.5044%-103 - C13 -4FW4 7.0 LPXC_PSEAE
26 PsiBlast_CBE 94.4844%-100 - C13 -4FW7 7.4 LPXC_PSEAE
10 PsiBlast_PDB 94.4844%-105 - C13 -4FW5 7.3 LPXC_PSEAE
21 PsiBlast_CBE 94.4644%-100 - C13 -4OKG 8.1 LPXC_PSEAE
23 PsiBlast_CBE 94.4244% -96 - C13 -2VES 6.0 LPXC_PSEAE
36 PsiBlast_CBE 94.3244%-101 - C13 -4FW4 7.0 LPXC_PSEAE
67 HHSearch 94.3044% -97 - C13 -3UHM 6.5 LPXC_PSEAE
35 PsiBlast_CBE 94.2644% -99 - C13 -4FW4 7.3 LPXC_PSEAE
4 PsiBlast_PDB 94.2344% -99 - C13 -4LCF 7.4 LPXC_PSEAE
11 PsiBlast_PDB 94.1844%-102 - C13 -4FW6 6.5 LPXC_PSEAE
18 PsiBlast_PDB 94.1041%-100 - C13 -3NZK 6.9 ?
29 PsiBlast_CBE 94.0044% -99 - C13 -4FW6 6.5 LPXC_PSEAE
30 PsiBlast_CBE 93.9944%-102 - C13 -4FW6 6.6 LPXC_PSEAE
8 PsiBlast_PDB 93.9944%-103 - C13 -4FW3 7.1 LPXC_PSEAE
13 PsiBlast_PDB 93.9644% -99 - C13 -4J3D 6.5 LPXC_PSEAE
38 PsiBlast_CBE 93.9044%-104 - C13 -4FW3 6.5 LPXC_PSEAE
7 PsiBlast_PDB 93.9044%-102 - C13 -4OKG 8.2 LPXC_PSEAE
33 PsiBlast_CBE 93.7944%-104 - C13 -4FW5 7.7 LPXC_PSEAE
5 PsiBlast_PDB 93.7544% -99 - C13 -4LCG 6.3 LPXC_PSEAE
3 PsiBlast_PDB 93.6544% -98 - C13 -3UHM 6.5 LPXC_PSEAE
6 PsiBlast_PDB 93.5844% -99 - C13 -4LCH 6.9 LPXC_PSEAE
40 PsiBlast_CBE 93.5644%-100 - C13 -4J3D 6.9 LPXC_PSEAE
27 PsiBlast_CBE 93.5444%-101 - C13 -4FW7 6.4 LPXC_PSEAE
12 PsiBlast_PDB 93.5044%-102 - C13 -4FW7 6.5 LPXC_PSEAE
22 PsiBlast_CBE 93.4844%-100 - C13 -3U1Y 8.1 LPXC_PSEAE
37 PsiBlast_CBE 93.3544%-104 - C13 -4FW3 7.2 LPXC_PSEAE
77 Fugue 87.4536% -89 * C13 *4OZE 2.0 LPXC_AQUAE
55 PsiBlast_CBE 87.1335%-101 - C13 -2J65 4.2 LPXC_AQUAE
65 PsiBlast_CBE 86.9535%-105 - C13 -4OZE 6.0 LPXC_AQUAE
52 PsiBlast_CBE 86.9535%-104 - C13 -3P76 7.1 LPXC_AQUAE
46 PsiBlast_CBE 86.9435%-100 - C13 -1YHC 3.7 LPXC_AQUAE
56 PsiBlast_CBE 86.9235%-101 - C13 -2J65 2.1 LPXC_AQUAE
47 PsiBlast_CBE 86.9135%-102 - C13 -1YHC 2.6 LPXC_AQUAE
66 PsiBlast_CBE 86.8535%-102 - C13 -4OZE 2.0 LPXC_AQUAE
53 PsiBlast_CBE 86.8335%-102 - C13 -2O3Z 3.4 LPXC_AQUAE
59 PsiBlast_CBE 86.8135%-100 - C13 -2IER 4.2 LPXC_AQUAE
54 PsiBlast_CBE 86.7735%-102 - C13 -2O3Z 2.7 LPXC_AQUAE
20 PsiBlast_PDB 86.7335%-101 - C13 -1YH8 2.4 LPXC_AQUAE
48 PsiBlast_CBE 86.7135%-101 - C13 -1YH8 4.4 LPXC_AQUAE
60 PsiBlast_CBE 86.6435%-100 - C13 -2IER 4.3 LPXC_AQUAE
50 PsiBlast_CBE 86.6435%-101 - C13 -4U3D 6.7 LPXC_AQUAE
57 PsiBlast_CBE 86.4935% -98 - C13 -2IES 4.7 LPXC_AQUAE
62 PsiBlast_CBE 86.4435%-102 - C13 -2GO4 5.4 LPXC_AQUAE
19 PsiBlast_PDB 86.3935% -98 - C13 -1P42 3.6 LPXC_AQUAE
64 PsiBlast_CBE 86.3735%-104 - C13 -2GO3 3.9 LPXC_AQUAE
49 PsiBlast_CBE 86.3335% -97 - C13 -1P42 3.9 LPXC_AQUAE
51 PsiBlast_CBE 86.1135%-101 - C13 -4U3B 5.2 LPXC_AQUAE
61 PsiBlast_CBE 85.9335%-101 - C13 -2GO4 4.9 LPXC_AQUAE
58 PsiBlast_CBE 85.8035% -97 - C13 -2IES 4.9 LPXC_AQUAE
63 PsiBlast_CBE 85.5335%-101 - C13 -2GO3 3.7 LPXC_AQUAE
78 Fugue 84.4534% -88 - C13 -1P42 3.6 LPXC_AQUAE