@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0386: (2015-12-15 )
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNNPNNPNNPINNQK

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

XNW_B_5(2XB9)
AROQ_HELPY
[Raw transfer]




9ZT_C_7(4B6R)
AROQ_HELPY
[Raw transfer]




9ZT_A_4(4B6R)
AROQ_HELPY
[Raw transfer]




JPS_A_2(2XDA)
AROQ_HELPY
[Raw transfer]




9ZT_B_5(4B6R)
AROQ_HELPY
[Raw transfer]




CB6_E_11(2WKS)
AROQ_HELPY
[Raw transfer]




CB6_B_8(2WKS)
AROQ_HELPY
[Raw transfer]




XNW_A_4(2XB9)
AROQ_HELPY
[Raw transfer]




CIT_C_6(2XB9)
AROQ_HELPY
[Raw transfer]




CB6_C_9(2WKS)
AROQ_HELPY
[Raw transfer]




CIT_A_2(2C4V)
AROQ_HELPY
[Raw transfer]




XD9_B_5(2XD9)
AROQ_HELPY
[Raw transfer]




XD9_C_6(2XD9)
AROQ_HELPY
[Raw transfer]




CB6_D_10(2WKS)
AROQ_HELPY
[Raw transfer]




2HN_C_7(4B6S)
AROQ_HELPY
[Raw transfer]




CB6_F_12(2WKS)
AROQ_HELPY
[Raw transfer]




XD9_A_4(2XD9)
AROQ_HELPY
[Raw transfer]




2HN_A_4(4B6S)
AROQ_HELPY
[Raw transfer]




2HN_B_6(4B6S)
AROQ_HELPY
[Raw transfer]




DQA_M_13(1J2Y)
AROQ_HELPY
[Raw transfer]




GOL_A_7(3LWZ)
AROQ_YERPE
[Raw transfer]




GAJ_A_2(2C4W)
AROQ_HELPY
[Raw transfer]




GAJ_A_2(2C4W)
AROQ_HELPY
[Raw transfer]




GOL_A_10(3LWZ)
AROQ_YERPE
[Raw transfer]




22 PsiBlast_CBE 96.69100%-146 - C6 -4B6S 7.8 AROQ_HELPY
2 PsiBlast_PDB 95.97100%-150 - C6 -2C4V 5.9 AROQ_HELPY
8 PsiBlast_PDB 95.94100%-145 - C6 -4B6S 8.2 AROQ_HELPY
21 PsiBlast_CBE 95.74100%-152 - C6 -4B6S 7.8 AROQ_HELPY
4 PsiBlast_PDB 95.07100%-144 - C6 -2XB9 5.8 AROQ_HELPY
39 PsiBlast_CBE 94.88100%-145 - C6 -2C57 - AROQ_HELPY -
28 PsiBlast_CBE 94.78100%-144 - C6 -2XB9 6.3 AROQ_HELPY
9 PsiBlast_PDB 94.54100%-148 - C6 -2C57 - AROQ_HELPY -
30 PsiBlast_CBE 94.47100%-149 - C6 -2WKS 9.7 AROQ_HELPY
27 PsiBlast_CBE 94.38100%-147 - C6 -2XB9 4.9 AROQ_HELPY
36 PsiBlast_CBE 94.29100%-144 - C6 -2C57 - AROQ_HELPY -
143 HHSearch 94.2199%-141 - C6 -2C4W 8.1 AROQ_HELPY
7 PsiBlast_PDB 94.07100%-145 - C6 -4B6R 6.8 AROQ_HELPY
23 PsiBlast_CBE 94.03100%-145 - C6 -4B6R 6.9 AROQ_HELPY
24 PsiBlast_CBE 94.00100%-145 - C6 -4B6R 6.8 AROQ_HELPY
33 PsiBlast_CBE 93.98100%-148 - C6 -2WKS 8.9 AROQ_HELPY
32 PsiBlast_CBE 93.89100%-150 - C6 -2WKS 9.6 AROQ_HELPY
34 PsiBlast_CBE 93.81100%-149 - C6 -2C57 - AROQ_HELPY -
42 PsiBlast_CBE 93.72100%-143 - C6 -2C57 - AROQ_HELPY -
43 PsiBlast_CBE 93.68100%-149 - C6 -2C57 - AROQ_HELPY -
31 PsiBlast_CBE 93.64100%-148 - C6 -2WKS 8.7 AROQ_HELPY
29 PsiBlast_CBE 93.61100%-148 - C6 -2WKS 9.2 AROQ_HELPY
25 PsiBlast_CBE 93.58100%-145 - C6 -2XD9 7.4 AROQ_HELPY
5 PsiBlast_PDB 93.58100%-145 - C6 -2XD9 7.8 AROQ_HELPY
1 PsiBlast_PDB 93.45100%-146 - C6 -1J2Y 3.6 AROQ_HELPY
26 PsiBlast_CBE 93.35100%-148 - C6 -2XD9 7.3 AROQ_HELPY
10 PsiBlast_PDB 93.1899%-142 - C6 -2C4W 8.1 AROQ_HELPY
6 PsiBlast_PDB 92.54100%-149 - C6 -2XDA 8.4 AROQ_HELPY
145 HHSearch 75.0544%-132 - C6 -3LWZ 2.8 AROQ_YERPE