@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0388: (2015-12-15 )
MMREILTNRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKSCFLYFKNHSKIGKIFSSPIYINPPFGYTNQPNFYNATIILKTSLGLRHFFALVFYIERRFGRARKRDFKDAPRTLDIDIIAFNQVILRQNDLTLPHPKWSERDSVLVPLTLQQILFKREEW

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GSY_B_4(4AD6)
?
[Raw transfer]




GSY_A_3(4AD6)
?
[Raw transfer]




PH2_A_9(2QX0)
?
[Raw transfer]




75 Fugue 97.8129%-106 - C11 -1Q0N - HPPK_ECOLI -
66 HHSearch 91.7529%-111 - C11 -1CBK - HPPK_HAEIN -
28 PsiBlast_CBE 90.2332%-126 - C11 -3UDV - HPPK_ECOLI -
29 PsiBlast_CBE 90.2232%-125 - C11 -3UDE - HPPK_ECOLI -
65 HHSearch 90.0433%-109 - C11 -2QX0 3.8 ?
68 HHSearch 89.8028%-144 - C11 -2CG8 - SULD_STRR6 -
24 PsiBlast_CBE 89.6535%-124 - C11 -3QBC - ? -
4 PsiBlast_PDB 89.6335%-125 - C11 -4CWB - ? -
9 PsiBlast_PDB 89.4632%-117 - C11 -1TMJ - HPPK_ECOLI -
23 PsiBlast_CBE 89.3835%-124 - C11 -4AD6 3.4 ?
8 PsiBlast_PDB 89.2932%-124 - C11 -3HT0 - HPPK_ECOLI -
3 PsiBlast_PDB 89.2335%-129 - C11 -4CRJ - ? -
6 PsiBlast_PDB 89.1834%-122 - C11 -2QX0 - ? -
59 PsiBlast_CBE 88.9532%-110 - C11 -1CBK - HPPK_HAEIN -
58 PsiBlast_CBE 88.8232%-113 - C11 -1CBK - HPPK_HAEIN -
48 PsiBlast_CBE 88.7632%-120 - C11 -1G4C - HPPK_ECOLI -
1 PsiBlast_PDB 88.6335%-126 - C11 -3QBC - ? -
22 PsiBlast_CBE 88.5135%-122 - C11 -4CYU - ? -
15 PsiBlast_PDB 88.4732%-102 - C11 -1Q0N - HPPK_ECOLI -
43 PsiBlast_CBE 88.3732%-118 - C11 -3HD2 - HPPK_ECOLI -
2 PsiBlast_PDB 87.9735%-123 - C11 -4AD6 3.0 ?