@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0390: (2015-12-15 )
MSNQASHLDNFMNAKNPKSFFDNKGNTKFIAITSGKGGVGKSNISANLAYSLYKKGYKVGVFDADIGLANLDVIFGVKTHKNILHALKGEAKLQEIICEIEPGLCLIPGDSGEEILKYISGAEALDRFVDEEGVLSSLDYIVIDTGAGIGATTQAFLNASDCVVIVTTPDPSAITDAYACIKINSKNKDELFLIANMVAQPKEGRATYERLFKVAKNNIASLELHYLGAIENSSLLKRYVRERKILRKIAPNDLFSQSIDQIASLLVSKLETGTLEIPKEGLKSFFKRLLKYLG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_4(4RZ3)
?
[Raw transfer]




ADP_A_3(4RZ3)
?
[Raw transfer]




ADP_B_4(4RZ3)
?
[Raw transfer]




1 PsiBlast_PDB 94.0531%-109 * C2 *4RZ3 2.7 ?
21 PsiBlast_CBE 93.4531%-109 - C2 -4RZ3 5.8 ?
58 HHSearch 85.3124% -97 - C2 -1G3Q - ? -
4 PsiBlast_PDB 84.4827%-100 - C2 -1HYQ - ? -
76 Fugue 82.5725% -79 - C2 -3Q9L - MIND_ECOLI -
53 HHSearch 81.3824% -92 - C2 -1HYQ - ? -
55 HHSearch 80.0823% -98 - C2 -3EA0 - ? -
57 HHSearch 79.6424% -95 - C2 -3Q9L - MIND_ECOLI -
59 HHSearch 77.9625% -97 - C2 -3K9G - ? -
75 Fugue 76.4422%-103 - C2 -3EA0 - ? -
61 HHSearch 75.0422% -88 - C2 -2OZE - ? -
80 Fugue 74.2826% -96 - C2 -3K9G - ? -
82 Fugue 73.4720% -65 - C2 -2XJ9 - ? -
77 Fugue 70.7422% -84 - C2 -3KJH - ? -
64 HHSearch 69.8516% -83 - C2 -3EZ2 - PARA_ECOLX -
56 HHSearch 69.3118%-105 - C2 -3FWY - BCHL_RHOS4 -
2 PsiBlast_PDB 68.7536%-101 - C2 -4V03 - ? -
67 HHSearch 68.5918% -76 - C2 -2XJ4 - ? -
5 PsiBlast_PDB 68.5933%-131 - C2 -1G3Q - ? -
6 PsiBlast_PDB 68.4633%-131 - C2 -1G3R - ? -