@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0532: (2015-12-16 )
MSLKRAKTKAQQIKELLLKHYPNQTTELRHKNPYELLVATILSAQCTDARVNQITPKLFEKYPSVNDLALASLEEVKEIIQSVSYSNNKSKHLISMGAKVVKDFKGVIPSTQKELMSLDGVGQKTANVVLSVCFDANYIAVDTHVFRTTHRLGLSNANTPIKTEEELSDLFKDNLSKLHHALILFGRYTCKAKNPLCDACFLKEFCVSKASFKA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_C_2(1ORN)
?
[Raw transfer]

-

NACID_C_2(1P59)
?
[Raw transfer]

-

NACID_C_2(1ORP)
?
[Raw transfer]

-

NACID_C_2(1ORN)
?
[Raw transfer]

-

1 PsiBlast_PDB 95.1743%-113 - C1 -1ORN 10.2 ?
2 PsiBlast_PDB 93.6343%-116 - C1 -1ORP 8.8 ?
3 PsiBlast_PDB 93.1142%-111 - C1 -1P59 9.8 ?
21 HHSearch 92.5936%-104 - C1 -2ABK - END3_ECOLI -
22 HHSearch 92.5241% -95 - C1 -1ORN 10.1 ?
4 PsiBlast_PDB 89.6338%-108 - C1 -2ABK - END3_ECOLI -
25 HHSearch 83.5624%-101 - C1 -1KG2 - MUTY_ECOLI -
24 HHSearch 83.1925%-101 - C1 -3N5N - MUTYH_HUMAN -
17 PsiBlast_PDB 81.9525% -95 - C1 -1KG2 - MUTY_ECOLI -
8 PsiBlast_PDB 81.7125% -96 - C1 -1KG4 - MUTY_ECOLI -
10 PsiBlast_PDB 81.2325% -96 - C1 -1KG6 - MUTY_ECOLI -
14 PsiBlast_PDB 81.1225% -91 - C1 -1WEF - MUTY_ECOLI -
12 PsiBlast_PDB 81.1023%-104 - C1 -4YPH - ? -
16 PsiBlast_PDB 80.8025% -92 - C1 -1MUY - MUTY_ECOLI -
13 PsiBlast_PDB 80.4825% -97 - C1 -1KG5 - MUTY_ECOLI -
7 PsiBlast_PDB 80.4723%-105 - C1 -3FSP - ? -
46 Fugue 80.3523% -97 - C1 -1RRQ - ? -
26 HHSearch 80.3324% -94 - C1 -3FSP - ? -
9 PsiBlast_PDB 80.1725% -92 - C1 -1WEG - MUTY_ECOLI -
18 PsiBlast_PDB 80.0925% -99 - C1 -1KG3 - MUTY_ECOLI -