@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0545: (2015-12-16 )
MFSKSLEALHHVKRYRKRELFDPLLKDYASNDYLGLSVKKDLLQNAFDKLQSFDCHSPKASMLVNGYHPLHAELEERLADLLEFESALLVGSGFLGNLALIDTLLVKNALLFMDAHYHASGIFSTKIKPNQVIFFSHNDIKDLKQKLFNAPKNKLKFIAIEGVYSMDASIAPYDFYEIIQETPNAFLIVDEAHSFGTIGENLLGFLEYHRIKEKDKIIKLSTFSKALASYGACVLAPLQVIEFLTNRAKSVIYTTALSLLDTALTLAHLEYFIAQKQELKNELSKHQQIIFETLGVRTPTGFFTLEFENNPALLNAQYFLKEKGFLVGAIRPPTVSKPLLRVSLSLKNSLEDTKELANALLDYSKIQSSFKSG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

KAM_A_5(1DJ9)
BIOF_ECOLI
[Raw transfer]




SER_A_2(3A2B)
?
[Raw transfer]




42 Fugue 92.1128% -86 - C1 -1BS0 - BIOF_ECOLI -
1 PsiBlast_PDB 91.3528%-100 - C1 -3A2B 3.3 ?
25 HHSearch 91.0924% -95 - C1 -2BWN - HEM1_RHOCB -
23 HHSearch 90.5827% -91 - C1 -3A2B - ? -
27 HHSearch 90.2029% -85 - C1 -1BS0 - BIOF_ECOLI -
21 HHSearch 86.1427% -90 - C1 -3WY7 - BIOF_MYCS2 -
4 PsiBlast_PDB 84.6028% -93 - C1 -2G6W - BIOF_ECOLI -
6 PsiBlast_PDB 84.4128% -95 - C1 -1DJE - BIOF_ECOLI -
24 HHSearch 84.3225% -91 - C1 -3TQX - ? -
5 PsiBlast_PDB 84.1828% -89 - C1 -1DJ9 4.6 BIOF_ECOLI
7 PsiBlast_PDB 84.0831%-101 - C1 -4IW7 - ? -
3 PsiBlast_PDB 84.0628% -90 - C1 -1BS0 - BIOF_ECOLI -
8 PsiBlast_PDB 83.1326% -97 - C1 -2W8J - ? -
2 PsiBlast_PDB 82.8029% -80 - C1 -3WY7 - BIOF_MYCS2 -
15 PsiBlast_PDB 81.8926% -97 - C1 -4BMK - ? -
9 PsiBlast_PDB 80.8426% -95 - C1 -2XBN - ? -
11 PsiBlast_PDB 80.7926% -96 - C1 -2W8W - ? -
28 HHSearch 79.5824% -85 - C1 -1FC4 - KBL_ECOLI -
10 PsiBlast_PDB 77.9326%-101 - C1 -2JGT - ? -
18 PsiBlast_PDB 77.5628% -99 - C1 -1FC4 - KBL_ECOLI -